Symbol:
Edn2
Name:
endothelin 2
RGD ID:
2533
Description:
Predicted to enable endothelin B receptor binding activity and hormone activity. Involved in several processes, including ovarian follicle rupture; phospholipase C-activating G protein-coupled receptor signaling pathway; and regulation of hormone secretion. Located in extracellular space. Biomarker of myocardial infarction. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human EDN2 (endothelin 2); PARTICIPATES IN endothelin signaling pathway; INTERACTS WITH ammonium chloride; bis(2-ethylhexyl) phthalate; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Endothelin isopeptide 2; endothelin-2; ET-2; Et2; PPET2; preproendothelin-2; RNEDN2S01; vasoactive intestinal contractor; VIC
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
EDN2 (endothelin 2) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Edn2 (endothelin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Edn2 (endothelin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
EDN2 (endothelin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
EDN2 (endothelin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Edn2 (endothelin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
EDN2 (endothelin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
EDN2 (endothelin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Edn2 (endothelin 2) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
HTATIP2 (HIV-1 Tat interactive protein 2) HGNC
OMA
Alliance orthologs 3
Homo sapiens (human):
EDN2 (endothelin 2)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Edn2 (endothelin 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
edn2 (endothelin 2)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Is Marker For:
QTLs:
Bp7
Candidate Gene For:
Bp7
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 139,036,576 - 139,042,074 (+) NCBI GRCr8 mRatBN7.2 5 133,751,316 - 133,756,814 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 133,751,217 - 133,756,814 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 136,479,131 - 136,484,624 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 138,235,562 - 138,241,057 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 138,256,179 - 138,261,668 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 139,098,472 - 139,106,396 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 139,100,898 - 139,105,792 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 142,891,221 - 142,896,115 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 140,742,686 - 140,747,580 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 140,747,827 - 140,753,399 (+) NCBI Celera 5 132,309,615 - 132,315,113 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - PID (archival)
Biological Process
angiogenesis (IEA,ISO) artery smooth muscle contraction (IEA,ISO) axon extension (IEA,ISO) blood vessel diameter maintenance (IEA) cell tip growth (IEA,ISO) cytokine-mediated signaling pathway (IEA,ISO) endothelial cell migration (IEA,ISO) energy homeostasis (IEA,ISO) intracellular calcium ion homeostasis (IBA) lung alveolus development (IEA,ISO) macrophage activation (IEA,ISO) macrophage chemotaxis (IEA,ISO) negative regulation of hormone secretion (IDA) neuron projection development (IEA,ISO) neutrophil chemotaxis (IEA,ISO) ovarian follicle rupture (IDA) phospholipase C-activating G protein-coupled receptor signaling pathway (IMP) positive regulation of calcium-mediated signaling (IEA,ISO) positive regulation of cell population proliferation (IEA,ISO) positive regulation of heart rate (IEA,ISO) positive regulation of hormone secretion (IDA) positive regulation of leukocyte chemotaxis (IEA,ISO) positive regulation of prostaglandin-endoperoxide synthase activity (ISO) positive regulation of smooth muscle contraction (IBA,IDA,IEA,ISO) prostaglandin biosynthetic process (IEA,ISO) regulation of systemic arterial blood pressure by endothelin (IBA,IEA,ISO) regulation of vasoconstriction (IEA) smooth muscle contraction (IEA,ISO) temperature homeostasis (IEA,ISO) vasculature development (IEA,ISO) vasoconstriction (IEA,ISO) vein smooth muscle contraction (IBA,IEA,ISO)
1.
cDNA cloning and chromosomal assignment of the endothelin 2 gene: vasoactive intestinal contractor peptide is rat endothelin 2.
Bloch KD, etal., Genomics 1991 May;10(1):236-42.
2.
Association between diastolic blood pressure and variants of the endothelin-1 and endothelin-2 genes.
Brown MJ, etal., J Cardiovasc Pharmacol. 2000;35(4 Suppl 2):S41-43.
3.
Endothelin release during ischaemia and reperfusion of isolated perfused rat hearts.
Brunner F, etal., J Mol Cell Cardiol. 1992 Nov;24(11):1291-305.
4.
Broadly altered gene expression in blood leukocytes in essential hypertension is absent during treatment.
Chon H, etal., Hypertension. 2004 May;43(5):947-51. Epub 2004 Mar 8.
5.
Regional and maturation-associated expression of endothelin 2 in rat gastrointestinal tract.
de la Monte SM, etal., J Histochem Cytochem. 1995 Feb;43(2):203-9.
6.
Structure and organization of the rat endothelin-2 gene.
Deng AY Mamm Genome 1997 Feb;8(2):157.
7.
Genetic mapping of two new blood pressure quantitative trait loci in the rat by genotyping endothelin system genes.
Deng AY, etal., J Clin Invest 1994 Jun;93(6):2701-9
8.
The effect of endothelin-1, endothelin-2 and endothelin-3 in early cerulein-induced acute pancreatitis in rats.
Dlugosz JW, etal., Rocz Akad Med Bialymst. 2004;49:85-92.
9.
Inhibition by phosphoramidon of the regional haemodynamic effects of proendothelin-2 and -3 in conscious rats.
Gardiner SM, etal., Br J Pharmacol. 1992 Oct;107(2):584-90.
10.
Genome scan and congenic strains for blood pressure QTL using Dahl salt-sensitive rats.
Garrett MR, etal., Genome Res 1998 Jul;8(7):711-23
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
13.
Potent constrictor actions of endothelin-1, endothelin-2, and endothelin-3 in rat isolated portal vein.
Guimaraes CL, etal., Hypertension. 1992 Feb;19(2 Suppl):II79-86.
14.
Myocardial expression of endothelin-2 is altered reciprocally to that of endothelin-1 during ischemia of cardiomyocytes in vitro and during heart failure in vivo.
Kakinuma Y, etal., Life Sci. 1999;65(16):1671-83.
15.
Endothelin activation of an inwardly rectifying K+ current in atrial cells.
Kim D Circ Res. 1991 Jul;69(1):250-5.
16.
Endothelin-2 in ovarian follicle rupture.
Ko C, etal., Endocrinology. 2006 Apr;147(4):1770-9. Epub 2006 Jan 12.
17.
Serum level of endothelin-1 and -2 in pregnancies complicated by EPH gestosis.
Leszczynska-Gorzelak B, etal., Gynecol Obstet Invest. 1997;43(1):37-40.
18.
Comparison of the cardiovascular and neural activity of endothelin-1, -2, -3 and respective proendothelins: effects of phosphoramidon and thiorphan.
Mattera GG, etal., Br J Pharmacol. 1993 Sep;110(1):331-7.
19.
Endothelins stimulate deoxyribonucleic acid synthesis and cell proliferation in rat adrenal zona glomerulosa, acting through an endothelin A receptor coupled with protein kinase C- and tyrosine kinase-dependent signaling pathways.
Mazzocchi G, etal., Endocrinology. 1997 Jun;138(6):2333-7.
20.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
21.
Inhibitory and facilitatory presynaptic effects of endothelin on sympathetic cotransmission in the rat isolated tail artery.
Mutafova-Yambolieva VN and Westfall DP, Br J Pharmacol. 1998 Jan;123(1):136-42.
22.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
23.
Contractile responses of smooth muscle cells differentiated from rat neural stem cells.
Oishi K, etal., J Physiol. 2002 Apr 1;540(Pt 1):139-52.
24.
Contractile responses and myosin phosphorylation in reconstituted fibers of smooth muscle cells from the rat cerebral artery.
Oishi K, etal., Jpn J Pharmacol. 2002 Sep;90(1):36-50.
25.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
26.
Differential effects of ET-1, ET-2, and ET-3 on pancreatic microcirculation, tissue integrity, and inflammation.
Plusczyk T, etal., Dig Dis Sci. 2001 Jun;46(6):1343-51.
27.
GOA pipeline
RGD automated data pipeline
28.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
29.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
30.
[Plasma concentrations of endothelin-1 and endothelin-2 in patients with pulmonary hypertension]
Salomon P, etal., Pol Merkuriusz Lek. 1999 Sep;7(39):111-3.
31.
Comparison of the pituitary effects of the mammalian endothelins: vasoactive intestinal contractor (endothelin-beta, rat endothelin-2) is a potent inhibitor of prolactin secretion.
Samson WK and Skala KD, Endocrinology. 1992 May;130(5):2964-70.
32.
Endothelin-mediated calcium signaling in preglomerular smooth muscle cells.
Schroeder AC, etal., Hypertension. 2000 Jan;35(1 Pt 2):280-6.
33.
Quantitative association between a newly identified molecular variant in the endothelin-2 gene and human essential hypertension.
Sharma P, etal., J Hypertens. 1999 Sep;17(9):1281-7.
34.
Endothelins induce Fos expression in neurons and glia in organotypic cultures of rat cerebellum.
Sullivan AM and Morton AJ, J Neurochem. 1996 Oct;67(4):1409-18.
35.
Plasma endothelin in patients with acute aortic disease.
Wagner A, etal., Resuscitation. 2002 Apr;53(1):71-6.
36.
Contribution of endogenous endothelin to the extension of myocardial infarct size in rats.
Watanabe T, etal., Circ Res. 1991 Aug;69(2):370-7.
Edn2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 139,036,576 - 139,042,074 (+) NCBI GRCr8 mRatBN7.2 5 133,751,316 - 133,756,814 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 133,751,217 - 133,756,814 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 136,479,131 - 136,484,624 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 138,235,562 - 138,241,057 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 138,256,179 - 138,261,668 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 139,098,472 - 139,106,396 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 139,100,898 - 139,105,792 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 142,891,221 - 142,896,115 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 140,742,686 - 140,747,580 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 140,747,827 - 140,753,399 (+) NCBI Celera 5 132,309,615 - 132,315,113 (+) NCBI Celera Cytogenetic Map 5 q36 NCBI
EDN2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 1 41,478,775 - 41,484,683 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 1 41,478,775 - 41,484,683 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 1 41,944,446 - 41,950,354 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 1 41,717,033 - 41,722,884 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 1 41,613,539 - 41,619,390 NCBI Celera 1 40,227,695 - 40,233,596 (-) NCBI Celera Cytogenetic Map 1 p34.2 NCBI HuRef 1 40,062,640 - 40,068,539 (-) NCBI HuRef CHM1_1 1 42,060,834 - 42,066,733 (-) NCBI CHM1_1 T2T-CHM13v2.0 1 41,348,976 - 41,370,636 (-) NCBI T2T-CHM13v2.0
Edn2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 120,018,403 - 120,024,557 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 120,018,403 - 120,024,557 (+) Ensembl GRCm39 Ensembl GRCm38 4 120,161,206 - 120,167,360 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 120,161,206 - 120,167,360 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 119,834,029 - 119,839,965 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 119,659,068 - 119,664,996 (+) NCBI MGSCv36 mm8 Celera 4 118,876,990 - 118,882,911 (+) NCBI Celera Cytogenetic Map 4 D2.1 NCBI cM Map 4 55.77 NCBI
Edn2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955537 1,228,070 - 1,233,797 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955537 1,228,062 - 1,233,784 (-) NCBI ChiLan1.0 ChiLan1.0
EDN2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 1 185,326,860 - 185,334,257 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 1 184,468,920 - 184,476,318 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 1 40,777,582 - 40,783,410 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 1 42,092,811 - 42,098,721 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 1 42,092,811 - 42,098,721 (-) Ensembl panpan1.1 panPan2
EDN2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 1,647,966 - 1,654,272 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 1,648,077 - 1,654,272 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 1,906,346 - 1,911,819 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 1,736,878 - 1,742,351 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 1,736,155 - 1,742,351 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 1,643,415 - 1,648,886 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 1,703,305 - 1,708,777 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 1,718,751 - 1,724,224 (+) NCBI UU_Cfam_GSD_1.0
Edn2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405058 57,236,189 - 57,239,728 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936474 23,060,905 - 23,064,566 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936474 23,061,219 - 23,064,525 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
EDN2
EDN2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 20 91,425,979 - 91,432,609 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 20 91,426,747 - 91,431,973 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666033 25,447,580 - 25,453,538 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Edn2
.
Predicted Target Of
Count of predictions: 93 Count of miRNA genes: 82 Interacting mature miRNAs: 86 Transcripts: ENSRNOT00000012569 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1331796 Thshl2 Thyroid stimulating hormone level QTL 2 2.3 blood thyroid-stimulating hormone amount (VT:0005119) serum thyroid stimulating hormone level (CMO:0001248) 5 97059760 147465714 Rat 10053720 Scort26 Serum corticosterone level QTL 26 2.06 0.0147 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 5 124965598 166875058 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 8552960 Pigfal15 Plasma insulin-like growth factor 1 level QTL 15 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 111416838 156416838 Rat 1300122 Wbc1 White blood cell count QTL 1 2.75 leukocyte quantity (VT:0000217) total white blood cell count (CMO:0000365) 5 125392826 139989768 Rat 7365049 Bp359 Blood pressure QTL 359 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128071929 134724733 Rat 61452 Ciaa5 CIA Autoantibody QTL 5 3.5 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 5 94858972 143070159 Rat 70156 Niddm30 Non-insulin dependent diabetes mellitus QTL 30 3.98 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 5 129132447 151006154 Rat 8552908 Pigfal4 Plasma insulin-like growth factor 1 level QTL 4 6.6 blood insulin-like growth factor amount (VT:0010479) plasma insulin-like growth factor 1 level (CMO:0001299) 5 128506074 166875058 Rat 1331803 Rf32 Renal function QTL 32 2.798 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 129132428 143070159 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 7794791 Mcs33 Mammary carcinoma susceptibility QTL 33 1.93 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 5 131345754 166875058 Rat 7207486 Bss109 Bone structure and strength QTL 109 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 5 106906205 151906205 Rat 7207481 Bss106 Bone structure and strength QTL 106 7.9 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 106906205 151906205 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1598861 Cm64 Cardiac mass QTL 64 2.9 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 127798274 166875058 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 631505 Bp103 Blood pressure QTL 103 3.2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 132717196 165560427 Rat 1549838 Bss4 Bone structure and strength QTL 4 9.2 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 5 106906205 151906205 Rat 1641920 Colcs1 Colorectal carcinoma susceptibility QTL 1 2.99 0.0055 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 5 121846814 166846814 Rat 2317753 Glom24 Glomerulus QTL 24 3.1 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 5 97570330 136479578 Rat 8694169 Bw148 Body weight QTL 148 5 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 128506074 166875058 Rat 8657050 Bw146 Body weight QTL 146 19.84 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 108938288 153938288 Rat 1581510 Cm54 Cardiac mass QTL 54 3.4 0.05 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 5 120740824 143608494 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 2317056 Wbc3 White blood cell count QTL 3 2.51 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 5 105999803 150999803 Rat 634349 Bp139 Blood pressure QTL 139 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 128924607 166875058 Rat 724525 Bp147 Blood pressure QTL 147 4.3 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 126424772 166875058 Rat 1598847 Cm62 Cardiac mass QTL 62 3.4 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 108845856 153845856 Rat 2293642 Bss37 Bone structure and strength QTL 37 4.64 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 5 120740824 151018848 Rat 1578673 Bmd13 Bone mineral density QTL 13 4.9 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 5 103689353 148689353 Rat 738018 Anxrr4 Anxiety related response QTL 4 5.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 5 130130159 166875058 Rat 7207488 Bss110 Bone structure and strength QTL 1 8.4 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 5 106906205 151906205 Rat 8694441 Bw169 Body weight QTL 169 17.61 0.001 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 5 111416838 156416838 Rat 631527 Tls1 T-lymphoma susceptibility QTL 1 0 0.001 thymus integrity trait (VT:0010555) post-insult time to onset of T-cell lymphoma (CMO:0001907) 5 90450144 135450144 Rat 7207491 Bss112 Bone structure and strength QTL 112 7 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 5 106906205 151906205 Rat 8694389 Bw160 Body weight QTL 160 6.17 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 5 111416838 156416838 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 8694198 Abfw3 Abdominal fat weight QTL 3 16.13 0.001 visceral adipose mass (VT:0010063) abdominal fat pad weight to body weight ratio (CMO:0000095) 5 111416838 156416838 Rat 1298089 Scl14 Serum cholesterol level QTL 14 5.8 0.0004 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 108845856 153845856 Rat 1598819 Bp292 Blood pressure QTL 292 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 127798274 166875058 Rat 1358187 Emca1 Estrogen-induced mammary cancer QTL 1 4.4 mammary gland integrity trait (VT:0010552) post-insult time to mammary tumor formation (CMO:0000345) 5 99216724 148607142 Rat
D5Mco19
Rat Assembly Chr Position (strand) Source JBrowse Cytogenetic Map 5 RGD
D5Mit19
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 139,037,822 - 139,038,027 (+) Marker Load Pipeline mRatBN7.2 5 133,752,562 - 133,752,767 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,102,145 - 139,102,349 NCBI Rnor6.0 Rnor_5.0 5 142,892,468 - 142,892,672 UniSTS Rnor5.0 RGSC_v3.4 5 140,743,932 - 140,744,137 RGD RGSC3.4 RGSC_v3.4 5 140,743,933 - 140,744,137 UniSTS RGSC3.4 RGSC_v3.1 5 140,749,159 - 140,749,363 RGD Celera 5 132,310,862 - 132,311,066 UniSTS RH 3.4 Map 5 875.2 RGD RH 3.4 Map 5 875.2 UniSTS RH 2.0 Map 5 877.1 RGD Cytogenetic Map 5 q36 UniSTS
D5Rat55
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 133,752,611 - 133,752,762 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,102,194 - 139,102,344 NCBI Rnor6.0 Rnor_5.0 5 142,892,517 - 142,892,667 UniSTS Rnor5.0 RGSC_v3.4 5 140,743,808 - 140,744,258 RGD RGSC3.4 RGSC_v3.4 5 140,743,982 - 140,744,132 UniSTS RGSC3.4 RGSC_v3.1 5 140,749,208 - 140,749,358 RGD Celera 5 132,310,911 - 132,311,061 UniSTS RH 3.4 Map 5 875.0 RGD RH 3.4 Map 5 875.0 UniSTS RH 2.0 Map 5 873.5 RGD FHH x ACI Map 5 70.92 RGD Cytogenetic Map 5 q36 UniSTS
D5Rat86
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 139,034,670 - 139,034,903 (+) Marker Load Pipeline mRatBN7.2 5 133,749,410 - 133,749,643 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,098,997 - 139,099,229 NCBI Rnor6.0 Rnor_5.0 5 142,889,320 - 142,889,552 UniSTS Rnor5.0 RGSC_v3.4 5 140,740,721 - 140,741,152 RGD RGSC3.4 RGSC_v3.4 5 140,740,781 - 140,741,013 UniSTS RGSC3.4 RGSC_v3.1 5 140,746,007 - 140,746,239 RGD Celera 5 132,307,710 - 132,307,942 UniSTS RH 3.4 Map 5 867.2 RGD RH 3.4 Map 5 867.2 UniSTS RH 2.0 Map 5 874.1 RGD SHRSP x BN Map 5 71.7299 RGD FHH x ACI Map 5 70.92 RGD Cytogenetic Map 5 q36 UniSTS
RH142434
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 5 139,035,865 - 139,036,080 (+) Marker Load Pipeline mRatBN7.2 5 133,750,605 - 133,750,820 (+) MAPPER mRatBN7.2 Rnor_6.0 5 139,100,192 - 139,100,406 NCBI Rnor6.0 Rnor_5.0 5 142,890,515 - 142,890,729 UniSTS Rnor5.0 RGSC_v3.4 5 140,741,976 - 140,742,190 UniSTS RGSC3.4 Celera 5 132,308,905 - 132,309,119 UniSTS Cytogenetic Map 5 q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
35
24
23
29
11
5
11
6
81
49
18
6
33
18
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000012569 ⟹ ENSRNOP00000012569
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 133,751,217 - 133,756,814 (+) Ensembl Rnor_6.0 Ensembl 5 139,100,898 - 139,105,792 (+) Ensembl
RefSeq Acc Id:
NM_012549 ⟹ NP_036681
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 139,036,576 - 139,042,074 (+) NCBI mRatBN7.2 5 133,751,316 - 133,756,814 (+) NCBI Rnor_6.0 5 139,100,898 - 139,106,396 (+) NCBI Rnor_5.0 5 142,891,221 - 142,896,115 (+) NCBI RGSC_v3.4 5 140,742,686 - 140,747,580 (+) RGD Celera 5 132,309,615 - 132,315,113 (+) NCBI
Sequence:
ATGGTCTCCCCGGCCTGGTGTTCCATTGCTCTGGCCCTACTTTTGGCCCTGCATGAAGGGAAGGGCCAGGCAGCTGCTACCATGGAGCAACCAGCCTCGGCACCCAAGGGCCGAGGACCCCACCTGCG
hide sequence
RefSeq Acc Id:
NP_036681 ⟸ NM_012549
- Peptide Label:
precursor
- UniProtKB:
P23943 (UniProtKB/Swiss-Prot), G3V771 (UniProtKB/TrEMBL), A6IRY1 (UniProtKB/TrEMBL)
- Sequence:
MVSPAWCSIALALLLALHEGKGQAAATMEQPASAPKGRGPHLRFRRCSCNSWLDKECVYFCHLDIIWVNTAGQTAPYGLGNPPRRRRRSLPKRCECSSAGDSACATFCHRRPWPEAEVTSSSQGPAAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000012569 ⟸ ENSRNOT00000012569
RGD ID: 13693988 Promoter ID: EPDNEW_R4512 Type: single initiation site Name: Edn2_1 Description: endothelin 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 139,100,818 - 139,100,878 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-06-10
Edn2
Endothelin isopeptide 2
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
mRNA expressed in pituitary and medulla oblongata
734466
