Advanced Search (OLGA)

Gene: Cyp4a2 (cytochrome P450, family 4, subfamily a, polypeptide 2) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Cyp4a2

Name:

cytochrome P450, family 4, subfamily a, polypeptide 2

RGD ID:

2479

Description:

Enables alkane 1-monooxygenase activity; arachidonate binding activity; and arachidonate monooxygenase activity. Involved in several processes, including fatty acid metabolic process; icosanoid biosynthetic process; and response to hormone. Predicted to be located in endoplasmic reticulum membrane. Biomarker of autosomal recessive polycystic kidney disease. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human CYP4A11 (cytochrome P450 family 4 subfamily A member 11) and CYP4A22 (cytochrome P450 family 4 subfamily A member 22); PARTICIPATES IN cytochrome P450 monooxygenase mediated pathway of arachidonic acid metabolism; linoleic acid metabolic pathway; arachidonic acid metabolic pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,2,2-tetramine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Cyp4a11; CYPIVA2; cytochrome P-450 K-2; cytochrome P450 4A2; cytochrome P450 4A2-like; cytochrome P450 K-5; cytochrome P450, subfamily 4A, polypeptide 11; Cytochrome P450, subfamily IVA, polypeptide 11; cytochrome P450-LA-omega 2; lauric acid omega-hydroxylase; LOC100365231; long-chain fatty acid omega-monooxygenase; P-450 IV4AII; P-450 K-2; P450 K-5; P450-LA-omega 2

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	CYP4A11 (cytochrome P450 family 4 subfamily A member 11)	HGNC	Panther, Treefam
Homo sapiens (human):	CYP4A22 (cytochrome P450 family 4 subfamily A member 22)	HGNC	Panther, Treefam
Alliance orthologs ³
Homo sapiens (human):	CYP4A11 (cytochrome P450 family 4 subfamily A member 11)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Cyp4a14 (cytochrome P450, family 4, subfamily a, polypeptide 14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cyp4a14 (cytochrome P450, family 4, subfamily a, polypeptide 14)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CYP4A22 (cytochrome P450 family 4 subfamily A member 22)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	cyp4t8 (cytochrome P450, family 4, subfamily T, polypeptide 8)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Cyp4d21	Alliance	DIOPT (Ensembl Compara\|OMA\|SonicParanoid)
Caenorhabditis elegans (roundworm):	cyp-29A3	Alliance	DIOPT (Ensembl Compara\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cyp4d20	Alliance	DIOPT (Ensembl Compara\|OMA\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cyp4b1.2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	cyp4b1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	cyp4b1.5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	cyp4b1.5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	cyp4b1.6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Allele / Splice:

Cyp4a2^em1Mcwi

Genetic Models:

SS-Chr 5^BN-Cyp4a2^em1Mcwi

Candidate Gene For:

Scl14 Rf54

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	134,160,356 - 134,170,908 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	134,160,358 - 134,176,156 (-)	Ensembl				GRCr8
mRatBN7.2	5	128,922,355 - 128,934,188 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	128,923,615 - 128,934,165 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	131,613,470 - 131,624,036 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	133,368,346 - 133,378,910 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	133,390,516 - 133,401,078 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	134,196,910 - 134,207,888 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	134,196,912 - 134,207,863 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	137,989,327 - 138,000,302 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	135,765,673 - 135,773,006 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
RGSC_v3.1	5	135,553,026 - 135,778,567 (-)	NCBI
Cytogenetic Map	5	q35	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal recessive polycystic kidney disease (IEP)

Vitamin A Deficiency (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

20-HETE (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4,5,3',4',5'-Hexachlorobiphenyl (EXP)

aflatoxin B1 (EXP)

Alisol A (EXP)

Alisol B (EXP)

Alisol C 23-acetate (EXP)

ammonium chloride (EXP)

Aroclor 1254 (EXP)

barium sulfate (EXP)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP)

chlorohydrocarbon (EXP)

clofibrate (EXP)

clofibric acid (EXP)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

dodecanoic acid (EXP)

endosulfan (EXP)

eugenol (EXP)

farnesol (EXP)

fenofibrate (EXP)

flutamide (EXP)

furan (EXP)

gemfibrozil (EXP)

genistein (EXP)

leflunomide (EXP)

lipopolysaccharide (EXP)

methoxychlor (EXP)

methylmercury chloride (EXP)

Muraglitazar (EXP)

N-nitrosodiethylamine (EXP)

nitrofen (EXP)

orotic acid (EXP)

perfluorodecanoic acid (EXP)

perfluorooctanoic acid (EXP)

phenformin (EXP)

phenobarbital (EXP)

pirinixic acid (EXP)

pravastatin (EXP)

pregnenolone 16alpha-carbonitrile (EXP)

rotenone (EXP)

streptozocin (EXP)

sucrose (EXP)

Sudan III (EXP)

sunitinib (EXP)

tert-butyl ethyl ether (EXP)

Tesaglitazar (EXP)

tetrachloromethane (EXP)

thioacetamide (EXP)

triclosan (EXP)

triphenyl phosphate (EXP)

troglitazone (EXP)

zaragozic acid A (EXP)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

arachidonate metabolic process (IBA,IMP,TAS)

fatty acid metabolic process (IEA)

icosanoid biosynthetic process (IBA,IMP)

kidney development (IBA,IEP)

lauric acid metabolic process (IBA,IDA)

linoleic acid metabolic process (IBA,IDA)

response to hormone (IEP)

response to xenobiotic stimulus (IEP)

Cellular Component

endoplasmic reticulum membrane (IEA)

Molecular Function

alkane 1-monooxygenase activity (IBA,IMP)

arachidonate 11,12-epoxygenase activity (TAS)

arachidonate binding (IDA)

arachidonate monooxygenase activity (IBA,IMP)

fatty acid binding (IDA)

heme binding (IEA)

iron ion binding (IEA)

long-chain fatty acid omega-hydroxylase activity (IEA)

metal ion binding (IEA)

monooxygenase activity (IEA)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

arachidonic acid metabolic pathway (IEA)

cytochrome P450 monooxygenase mediated pathway of arachidonic acid metabolism (IMP)

eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma (IEA)

fatty acid metabolic pathway (IEA)

linoleic acid metabolic pathway (IDA)

retinol metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Contribution of cytochrome P450 4A isoforms to renal functional response to inhibition of nitric oxide production in the rat.	Hercule HC, etal., J Physiol. 2003 Sep 15;551(Pt 3):971-9. Epub 2003 Jul 11.
4.	Structural determination of the substrate specificities and regioselectivities of the rat and human fatty acid omega-hydroxylases.	Hoch U, etal., Arch Biochem Biophys. 2000 Jan 1;373(1):63-71.
5.	Regulation of renal cytochrome P450s by thyroid hormone in diabetic rats.	Imaoka S, etal., Biochem Pharmacol. 1993 Dec 14;46(12):2197-200.
6.	Developmentally regulated expression of the CYP4A genes in the spontaneously hypertensive rat kidney.	Kroetz DL, etal., Mol Pharmacol. 1997 Sep;52(3):362-72.
7.	Cytochrome P-450 4A isoform expression and 20-HETE synthesis in renal preglomerular arteries.	Marji JS, etal., Am J Physiol Renal Physiol 2002 Jul;283(1):F60-7.
8.	Association of the T8590C polymorphism of CYP4A11 with hypertension in the MONICA Augsburg echocardiographic substudy.	Mayer B, etal., Hypertension. 2005 Oct;46(4):766-71. Epub 2005 Sep 6.
9.	Differential regulation of endobiotic-oxidizing cytochromes P450 in vitamin A-deficient male rat liver.	Murray M, etal., Br J Pharmacol. 2001 Dec;134(7):1487-97. doi: 10.1038/sj.bjp.0704380.
10.	Induction of cytochrome P450 isozymes in rat renal microsomes by cyclosporin A.	Nakamura M, etal., Biochem Pharmacol. 1994 Nov 1;48(9):1743-6.
11.	Kinetic profile of the rat CYP4A isoforms: arachidonic acid metabolism and isoform-specific inhibitors.	Nguyen X, etal., Am J Physiol. 1999 Jun;276(6 Pt 2):R1691-700.
12.	Chronic blockade of 20-HETE synthesis reduces polycystic kidney disease in an orthologous rat model of ARPKD.	Park F, etal., Am J Physiol Renal Physiol. 2009 Jan 7.
13.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
14.	GOA pipeline	RGD automated data pipeline
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1739747	PMID:2306108	PMID:2766932	PMID:11139583	PMID:12477932	PMID:15280100	PMID:15489334	PMID:16543501	PMID:19675180	PMID:27174801	PMID:27194719

Genomics

Variants

Variants in Cyp4a2
64 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	49
Interacting mature miRNAs:	51
Transcripts:	ENSRNOT00000051252
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	130678987	145274255	Rat
7365049	Bp359	Blood pressure QTL 359			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133308734	140009902	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

D5Mcw1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	129,098,900 - 129,099,033 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	128,924,597 - 128,924,722 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	134,469,641 - 134,469,771	NCBI	Rnor6.0
Rnor_6.0	5	134,197,895 - 134,198,019	NCBI	Rnor6.0
Rnor_5.0	5	138,259,603 - 138,259,733	UniSTS	Rnor5.0
Rnor_5.0	5	137,990,312 - 137,990,436	UniSTS	Rnor5.0
RGSC_v3.4	5	135,877,115 - 135,877,245	UniSTS	RGSC3.4
Celera	5	127,636,592 - 127,636,722	UniSTS
Cytogenetic Map	5	q36	UniSTS

D5Wox12

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	129,098,910 - 129,099,034 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	128,924,607 - 128,924,723 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	134,469,651 - 134,469,772	NCBI	Rnor6.0
Rnor_6.0	5	134,197,905 - 134,198,020	NCBI	Rnor6.0
Rnor_5.0	5	138,259,613 - 138,259,734	UniSTS	Rnor5.0
Rnor_5.0	5	137,990,322 - 137,990,437	UniSTS	Rnor5.0
RGSC_v3.4	5	135,877,125 - 135,877,246	UniSTS	RGSC3.4
RGSC_v3.4	5	135,877,124 - 135,877,246	RGD	RGSC3.4
Celera	5	127,636,602 - 127,636,723	UniSTS
RGSC_v3.1	5	135,882,350 - 135,882,472	RGD
RH 3.4 Map	5	837.7	RGD
RH 3.4 Map	5	837.7	UniSTS
Cytogenetic Map	5	q36	UniSTS

D5Wox2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	153,223,414 - 153,223,528 (+)	Marker Load Pipeline
mRatBN7.2	5	147,939,831 - 147,939,945 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	154,056,366 - 154,056,479	NCBI	Rnor6.0
Rnor_5.0	5	157,821,821 - 157,821,934	UniSTS	Rnor5.0
RGSC_v3.4	5	154,480,646 - 154,480,760	RGD	RGSC3.4
RGSC_v3.4	5	154,480,647 - 154,480,760	UniSTS	RGSC3.4
Celera	5	146,349,162 - 146,349,275	UniSTS
RGSC_v3.1	5	154,490,686 - 154,490,799	RGD
RH 3.4 Map	5	999.3	RGD
RH 3.4 Map	5	999.3	UniSTS
RH 2.0 Map	5	951.1	RGD
Cytogenetic Map	5	q36	UniSTS

RH131600

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	129,098,021 - 129,098,201 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	128,923,713 - 128,923,893 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	129,010,601 - 129,010,781 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	134,468,762 - 134,468,941	NCBI	Rnor6.0
Rnor_6.0	5	134,197,011 - 134,197,190	NCBI	Rnor6.0
Rnor_5.0	5	138,258,724 - 138,258,903	UniSTS	Rnor5.0
Rnor_5.0	5	137,989,428 - 137,989,607	UniSTS	Rnor5.0
RGSC_v3.4	5	135,876,236 - 135,876,415	UniSTS	RGSC3.4
Celera	5	127,635,713 - 127,635,892	UniSTS
RH 3.4 Map	5	836.4	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH141571

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	128,932,273 - 128,932,462 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	129,113,516 - 129,113,665 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	129,019,159 - 129,019,348 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	134,205,972 - 134,206,160	NCBI	Rnor6.0
Rnor_5.0	5	137,998,389 - 137,998,577	UniSTS	Rnor5.0
RGSC_v3.4	5	135,771,115 - 135,771,303	UniSTS	RGSC3.4
RH 3.4 Map	5	837.7	UniSTS
Cytogenetic Map	5	q36	UniSTS

Genetic Models

This gene Cyp4a2 is modified in the following models/strains:

SS-Chr 5^BN-Cyp4a2^em1Mcwi

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
4	9	13	40	86	86	55	28	55	4	202	62	22	73	29	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001044770	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC078684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M57719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000045571 ⟹ ENSRNOP00000045567

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	128,923,615 - 128,934,165 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000051252 ⟹ ENSRNOP00000042072

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	134,196,912 - 134,207,863 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000083686 ⟹ ENSRNOP00000072485

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	134,197,521 - 134,207,847 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000088209 ⟹ ENSRNOP00000074484

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	134,196,915 - 134,207,859 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111375 ⟹ ENSRNOP00000082696

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	128,923,615 - 128,934,165 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118610 ⟹ ENSRNOP00000086519

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	134,160,358 - 134,170,892 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000125424 ⟹ ENSRNOP00000100031

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	134,160,358 - 134,176,156 (-)	Ensembl

RefSeq Acc Id:

NM_001044770 ⟹ NP_001038235

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	134,160,356 - 134,170,908 (-)	NCBI
mRatBN7.2	5	128,923,613 - 128,934,165 (-)	NCBI
Rnor_6.0	5	134,196,910 - 134,207,863 (-)	NCBI
Rnor_5.0	5	137,989,327 - 138,000,302 (-)	NCBI
RGSC_v3.4	5	135,765,673 - 135,773,006 (-)	RGD

Sequence:

show sequence

CCAGAAGCCATTAACCATGGGTTTCTCTGTATTTAGCCCTACAAGATCCCTGGATGGTGTCTCT
GGGTTCTTCCAAGGGGCCTTCTTGCTCAGTCTATTTCTGGTGCTGTTCAAGGCAGTCCAATTCT
ACTTACGAAGGCAATGGCTGCTCAAGGCCCTCGAGAAGTTCCCATCCACGCCTTCCCACTGGCT
TTGGGGCCACAACCTGAAGGATAGAGAATTCCAGCAGGTTCTTACGTGGGTAGAGAAATTCCCA
GGTGCCTGCTTACAGTGGCTCTCAGGGAGCACAGCACGAGTCCTGCTCTATGACCCTGACTATG
TGAAGGTGGTTCTGGGAAGATCAGATCCAAAGCCTTATCAATCCCTTGCTCCCTGGATTGGTTA
TGGTTTGCTCCTGTTGAATGGAAAGAAATGGTTCCAGCATCGGCGGATGTTGACTCCAGCCTTC
CACTATGACATCCTCAAACCCTATGTCAAAATCATGGCGGACTCTGTCAGTATAATGCTAGACA
AATGGGAGAAGCTTGATGACCAGGATCACCCTCTAGAGATCTTCCACTATGTCTCCTTGATGAC
ACTGGACACTGTTATGAAGTGTGCTTTCAGCCACCAGGGCAGTGTTCAGTTGGATGTAAATTCC
AGGTCCTACACCAAGGCTGTTGAGGATCTAAACAACCTGATTTTCTTTCGTGTGAGGAGTGCCT
TTTATGGGAACAGCATCATCTACAATATGTCCTCTGATGGCCGTTTGTCCCGCCGGGCCTGCCA
GATTGCTCATGAGCACACAGATGGAGTGATCAAAACGAGGAAGGCTCAGCTGCAGAATGAGGAA
GAGCTTCAGAAGGCCAGGAAGAAGAGGCACTTGGATTTCCTGGACATCCTGTTGTTTGCCAAAA
TGGAGGATGGGAAGAGCTTGTCAGATGAGGACCTGCGTGCAGAGGTGGACACATTCATGTTTGA
GGGTCATGACACCACAGCCAGTGGAATCTCCTGGGTTTTCTATGCTCTGGCCACCCACCCTGAG
CACCAAGAGAGATGCAGAGAGGAGGTGCAGAGCATTCTGGGTGATGGAACCTCTGTCACATGGG
ACCACCTGGACCAGATGCCTTACACCACCATGTGCATCAAGGAGGCCCTGAGGCTCTACTCACC
TGTACCTTCTGTGAGTCGAGAGCTCAGCTCCCCTGTCACCTTCCCAGATGGACGTTCCATACCC
AAAGGTATCAGAGTCACAATTTTAATTTATGGTCTTCATCATAACCCAAGTTACTGGCCAAACC
CAAAGGTGTTTGACCCCTCTAGATTCTCACCAGATTCTCCTCGCCATAGCCATGCTTATCTGCC
ATTCTCAGGAGGAGCAAGGAACTGCATTGGGAAACAATTTGCCATGAATGAGCTGAAGGTAGCT
GTGGCCCTGACCCTGCTTCGCTTTGAGTTGCTGCCAGATCCCACCAGGATCCCGGTCCCCATGC
CAAGACTTGTGTTGAAGTCCAAGAATGGGATCCACCTGCGTCTCAAGAAGCTAAGATAATTCTG
GTGGAGATAGGACAGCTCCAAAGCTTTTACTCCAGACACCTTCCCAGCTTGTGTGTGTACCCAT
TTCCCATCTGGTTTCACCTCTGACCAGCCACTGAACCTGCCGCCAGCAGCCCGTCCTCCAGCCT
GCTTACCCATCATCATCATTGGACTAACAGAGAAAGATGTATTTTAGAGGGAAACTCTTGCACT
TTATCTCCCTTCAGTTCTCAGAGTCTTGGGACAATCGGCATCATGAATTAAAATGTTCTTAGAT
ATCACATGCTGGGAGAAAATTAATCCTAAAGATTCTGGCACCAGCCAGAGGAAGGAAGGTGACT
CAAAAGAAGAGATTTCTAGATATTTCTGATTGTCTCATGGTGAAATTAATGTATGCCTCATCTT
TTCTATGAAATAATAGTACTGATGCAGAACAGTAGATAGAAATGAATAGTTTTTACTACTTTGG
GCCAAACTGTAAATAAATCCATTTCACTTCATTAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001038235	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41039	(Get FASTA)	NCBI Sequence Viewer
	AAH78684	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000082696.1
	ENSRNOP00000088666.1
	ENSRNOP00000100031
GenBank Protein	P20816	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001038235 ⟸ NM_001044770

- UniProtKB:

Q4G071 (UniProtKB/Swiss-Prot), P20816 (UniProtKB/Swiss-Prot), F1M7X1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGFSVFSPTRSLDGVSGFFQGAFLLSLFLVLFKAVQFYLRRQWLLKALEKFPSTPSHWLWGHNL
KDREFQQVLTWVEKFPGACLQWLSGSTARVLLYDPDYVKVVLGRSDPKPYQSLAPWIGYGLLLL
NGKKWFQHRRMLTPAFHYDILKPYVKIMADSVSIMLDKWEKLDDQDHPLEIFHYVSLMTLDTVM
KCAFSHQGSVQLDVNSRSYTKAVEDLNNLIFFRVRSAFYGNSIIYNMSSDGRLSRRACQIAHEH
TDGVIKTRKAQLQNEEELQKARKKRHLDFLDILLFAKMEDGKSLSDEDLRAEVDTFMFEGHDTT
ASGISWVFYALATHPEHQERCREEVQSILGDGTSVTWDHLDQMPYTTMCIKEALRLYSPVPSVS
RELSSPVTFPDGRSIPKGIRVTILIYGLHHNPSYWPNPKVFDPSRFSPDSPRHSHAYLPFSGGA
RNCIGKQFAMNELKVAVALTLLRFELLPDPTRIPVPMPRLVLKSKNGIHLRLKKLR

hide sequence

Ensembl Acc Id:

ENSRNOP00000042072 ⟸ ENSRNOT00000051252

Ensembl Acc Id:

ENSRNOP00000072485 ⟸ ENSRNOT00000083686

Ensembl Acc Id:

ENSRNOP00000074484 ⟸ ENSRNOT00000088209

Ensembl Acc Id:

ENSRNOP00000045567 ⟸ ENSRNOT00000045571

Ensembl Acc Id:

ENSRNOP00000082696 ⟸ ENSRNOT00000111375

Ensembl Acc Id:

ENSRNOP00000086519 ⟸ ENSRNOT00000118610

Ensembl Acc Id:

ENSRNOP00000100031 ⟸ ENSRNOT00000125424

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20816-F1-model_v2	AlphaFold	P20816	1-504	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693917

Promoter ID:

EPDNEW_R4442

Type:

multiple initiation site

Name:

Cyp4a2_1

Description:

cytochrome P450, family 4, subfamily a, polypeptide 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	134,207,875 - 134,207,935	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2479	AgrOrtholog
BioCyc Gene	G2FUF-40290	BioCyc
Ensembl Genes	ENSRNOG00000030154	Ensembl
	ENSRNOG00000064139	UniProtKB/Swiss-Prot
	ENSRNOG00000066487	Ensembl, UniProtKB/Swiss-Prot
	ENSRNOG00000082592	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000111375.1	UniProtKB/Swiss-Prot
	ENSRNOT00000115710.1	UniProtKB/Swiss-Prot
	ENSRNOT00000125424	ENTREZGENE
Gene3D-CATH	1.10.630.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7109305	IMAGE-MGC_LOAD
InterPro	Cyt_P450	UniProtKB/Swiss-Prot
	Cyt_P450_CS	UniProtKB/Swiss-Prot
	Cyt_P450_E_grp-I	UniProtKB/Swiss-Prot
	Cyt_P450_sf	UniProtKB/Swiss-Prot
	Cytochrome_P450_Monoox	UniProtKB/Swiss-Prot
KEGG Report	rno:24306	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:93048	IMAGE-MGC_LOAD
NCBI Gene	24306	ENTREZGENE
PANTHER	CYTOCHROME P450 4A14-RELATED	UniProtKB/Swiss-Prot
	CYTOCHROME P450 FAMILY 4	UniProtKB/Swiss-Prot
Pfam	p450	UniProtKB/Swiss-Prot
PhenoGen	Cyp4a2	PhenoGen
PRINTS	EP450I	UniProtKB/Swiss-Prot
	P450	UniProtKB/Swiss-Prot
PROSITE	CYTOCHROME_P450	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000030154	RatGTEx
	ENSRNOG00000064139	RatGTEx
	ENSRNOG00000066487	RatGTEx
	ENSRNOG00000082592	RatGTEx
Superfamily-SCOP	SSF48264	UniProtKB/Swiss-Prot
UniProt	CP4A2_RAT	UniProtKB/Swiss-Prot
	F1M7X1	ENTREZGENE, UniProtKB/TrEMBL
	H7C5X2_RAT	UniProtKB/TrEMBL
	P20816	ENTREZGENE
	Q4G071	ENTREZGENE
UniProt Secondary	Q4G071	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-03-29	Cyp4a2	cytochrome P450, family 4, subfamily a, polypeptide 2	LOC100365231	cytochrome P450 4A2-like	Data merged from RGD:2319443	737654	PROVISIONAL
2010-05-05	LOC100365231	cytochrome P450 4A2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2007-07-06	Cyp4a2	cytochrome P450, family 4, subfamily a, polypeptide 2	Cyp4a11	cytochrome P450, subfamily 4A, polypeptide 11	Name updated	1299863	APPROVED
2002-11-06	Cyp4a11	cytochrome P450, subfamily4A, polypeptide 11		Cytochrome P450, subfamily IVA, polypeptide 11	Name updated	625702	APPROVED
2002-06-10	Cyp4a11	Cytochrome P450, subfamily IVA, polypeptide 11			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in nephron segments and preglomerular arterioles of the kidneys	628319
gene_function	catalyzes the hydroxylation of omega-terminal -carbon of the arachidonic acid to 20-hydroxyeicosatetraenoic acid (20-HETE)	628319
gene_regulation	protein expression increases with decreased arterial diameter	628319
gene_transcript	possesses a TATA-less promoter	727598

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)