Symbol:
Cd3d
Name:
CD3 delta subunit of T-cell receptor complex
RGD ID:
2304
Description:
Predicted to enable identical protein binding activity and transmembrane signaling receptor activity. Predicted to be involved in cell surface receptor signaling pathway and positive thymic T cell selection. Predicted to be located in plasma membrane. Predicted to be part of alpha-beta T cell receptor complex. Predicted to be active in external side of plasma membrane. Human ortholog(s) of this gene implicated in immunodeficiency 19 and severe combined immunodeficiency. Orthologous to human CD3D (CD3 delta subunit of T-cell receptor complex); PARTICIPATES IN adaptive immune response pathway; interleukin-12 signaling pathway; Chagas disease pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 7,12-dimethyltetraphene; acetamide.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CD3 antigen delta polypeptide; CD3 molecule delta polypeptide; CD3 molecule, delta; CD3d molecule; T-cell receptor T3 delta chain; T-cell surface glycoprotein CD3 delta chain
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
CD3D (CD3 delta subunit of T-cell receptor complex) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Cd3d (CD3 antigen, delta polypeptide) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Cd3d (CD3d molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
LOC100979946 (T-cell surface glycoprotein CD3 delta chain) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
CD3D (CD3 delta subunit of T-cell receptor complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Cd3d (CD3d molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
CD3D (CD3 delta subunit of T-cell receptor complex) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
CD3D (CD3d molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Cd3d (CD3d molecule) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Cd3d (CD3 antigen, delta polypeptide)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
CD3D (CD3 delta subunit of T-cell receptor complex)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):
cd3g
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoInspector|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 54,184,573 - 54,190,112 (+) NCBI GRCr8 mRatBN7.2 8 45,287,803 - 45,293,342 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 45,288,749 - 45,301,809 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 50,784,363 - 50,788,968 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 49,063,089 - 49,067,694 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 46,933,645 - 46,938,252 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 49,282,502 - 49,287,095 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 49,282,460 - 49,287,110 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,900,331 - 47,905,113 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,932,151 - 47,936,744 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 47,940,916 - 47,945,510 (+) NCBI Celera 8 44,873,511 - 44,878,104 (+) NCBI Celera RH 3.4 Map 8 450.1 RGD Cytogenetic Map 8 q22 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cd3d Rat 1,2-dimethylhydrazine increases expression ISO Cd3d (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of CD3D mRNA CTD PMID:22206623 Cd3d Rat 17alpha-ethynylestradiol decreases expression ISO Cd3d (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of CD3D mRNA CTD PMID:17942748 Cd3d Rat 17alpha-ethynylestradiol affects expression ISO Cd3d (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of CD3D mRNA CTD PMID:14976129 and PMID:17555576 Cd3d Rat 17alpha-ethynylestradiol multiple interactions ISO Cd3d (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of CD3D mRNA CTD PMID:17942748 Cd3d Rat 17beta-estradiol decreases expression ISO Cd3d (Mus musculus) 6480464 Estradiol results in decreased expression of CD3D mRNA CTD PMID:19484750 Cd3d Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cd3d (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CD3D mRNA CTD PMID:18343893 Cd3d Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of CD3D mRNA CTD PMID:34747641 Cd3d Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Cd3d (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of CD3D mRNA CTD PMID:16611356 more ... Cd3d Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Cd3d (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in decreased expression of CD3D mRNA CTD PMID:17942748 Cd3d Rat 2,3,7,8-Tetrachlorodibenzofuran affects expression ISO Cd3d (Mus musculus) 6480464 2 more ... CTD PMID:18343893 Cd3d Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Cd3d (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Cd3d Rat 2,6-di-tert-butyl-4-methylphenol decreases expression ISO Cd3d (Mus musculus) 6480464 Butylated Hydroxytoluene results in decreased expression of CD3D mRNA CTD PMID:19925653 Cd3d Rat 3-methylcholanthrene decreases expression ISO Cd3d (Mus musculus) 6480464 Methylcholanthrene results in decreased expression of CD3D mRNA CTD PMID:25926378 Cd3d Rat 4,4'-diaminodiphenylmethane decreases expression ISO Cd3d (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of CD3D mRNA CTD PMID:18648102 Cd3d Rat 4-hydroxyphenyl retinamide decreases expression ISO Cd3d (Mus musculus) 6480464 Fenretinide results in decreased expression of CD3D mRNA CTD PMID:28973697 Cd3d Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:19480007 Cd3d Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of CD3D mRNA CTD PMID:31881176 Cd3d Rat aflatoxin B1 affects expression ISO CD3D (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of CD3D protein CTD PMID:20106945 Cd3d Rat aflatoxin B1 increases methylation ISO CD3D (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of CD3D gene CTD PMID:27153756 Cd3d Rat aflatoxin B1 increases expression ISO CD3D (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of CD3D mRNA CTD PMID:21632981 and PMID:22100608 Cd3d Rat all-trans-retinoic acid decreases expression ISO CD3D (Homo sapiens) 6480464 Tretinoin results in decreased expression of CD3D mRNA CTD PMID:33167477 Cd3d Rat alpha-Zearalanol increases expression EXP 6480464 Zeranol results in increased expression of CD3D mRNA CTD PMID:35163327 Cd3d Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CD3D mRNA CTD PMID:16483693 Cd3d Rat amphetamine decreases expression EXP 6480464 Amphetamine results in decreased expression of CD3D mRNA CTD PMID:30779732 Cd3d Rat antirheumatic drug decreases expression ISO CD3D (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of CD3D mRNA CTD PMID:24449571 Cd3d Rat aristolochic acid A multiple interactions EXP 6480464 [aristolochic acid I co-treated with aristolochic acid II] results in increased expression of CD3D mRNA CTD PMID:23912714 Cd3d Rat benzene increases expression ISO CD3D (Homo sapiens) 6480464 Benzene results in increased expression of CD3D mRNA CTD PMID:22214187 Cd3d Rat benzo[a]pyrene decreases expression ISO Cd3d (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of CD3D mRNA CTD PMID:21569818 Cd3d Rat benzo[a]pyrene increases expression ISO CD3D (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CD3D mRNA CTD PMID:20106945 more ... Cd3d Rat benzo[b]fluoranthene increases expression ISO Cd3d (Mus musculus) 6480464 benzo(b)fluoranthene results in increased expression of CD3D mRNA CTD PMID:26377693 Cd3d Rat bis(2-ethylhexyl) phthalate increases expression ISO Cd3d (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of CD3D mRNA CTD PMID:35550907 Cd3d Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CD3D mRNA CTD PMID:18180321 Cd3d Rat bisphenol A increases expression ISO Cd3d (Mus musculus) 6480464 bisphenol A results in increased expression of CD3D mRNA CTD PMID:35752395 and PMID:38701888 Cd3d Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CD3D gene CTD PMID:28505145 Cd3d Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CD3D mRNA CTD PMID:25181051 Cd3d Rat cadmium atom decreases expression ISO CD3D (Homo sapiens) 6480464 Cadmium results in decreased expression of CD3D mRNA CTD PMID:24376830 Cd3d Rat cadmium dichloride increases expression ISO Cd3d (Mus musculus) 6480464 Cadmium Chloride results in increased expression of CD3D mRNA CTD PMID:24982889 Cd3d Rat calcidiol multiple interactions ISO CD3D (Homo sapiens) 6480464 Calcifediol promotes the reaction [[[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased expression of VDR protein] and Ketoconazole inhibits the reaction [Calcifediol promotes the reaction [[[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased expression of VDR protein]] CTD PMID:24792400 Cd3d Rat calcitriol multiple interactions ISO CD3D (Homo sapiens) 6480464 [[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased abundance of Calcitriol more ... CTD PMID:24792400 Cd3d Rat carbon nanotube affects expression ISO Cd3d (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of CD3D mRNA CTD PMID:25554681 Cd3d Rat carbon nanotube decreases expression ISO Cd3d (Mus musculus) 6480464 Nanotubes and Carbon analog results in decreased expression of CD3D mRNA CTD PMID:25554681 and PMID:25620056 Cd3d Rat CGP 52608 multiple interactions ISO CD3D (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CD3D gene] CTD PMID:28238834 Cd3d Rat chloroprene decreases expression ISO Cd3d (Mus musculus) 6480464 Chloroprene results in decreased expression of CD3D mRNA CTD PMID:23125180 Cd3d Rat chlorpyrifos decreases expression ISO Cd3d (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CD3D mRNA CTD PMID:32715474 Cd3d Rat clofibrate increases expression ISO Cd3d (Mus musculus) 6480464 Clofibrate results in increased expression of CD3D mRNA CTD PMID:17585979 Cd3d Rat copper(II) sulfate increases expression ISO CD3D (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CD3D mRNA CTD PMID:19549813 Cd3d Rat cyclophosphamide decreases expression ISO Cd3d (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of CD3D mRNA CTD PMID:21041162 Cd3d Rat dexamethasone decreases expression ISO Cd3d (Mus musculus) 6480464 Dexamethasone results in decreased expression of CD3D mRNA CTD PMID:21041162 Cd3d Rat diethylstilbestrol decreases expression ISO Cd3d (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of CD3D mRNA CTD PMID:21041162 Cd3d Rat diuron decreases expression ISO CD3D (Homo sapiens) 6480464 Diuron results in decreased expression of CD3D mRNA CTD PMID:35967413 Cd3d Rat dorsomorphin multiple interactions ISO CD3D (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CD3D mRNA CTD PMID:27188386 Cd3d Rat furan increases expression EXP 6480464 furan results in increased expression of CD3D mRNA CTD PMID:27387713 Cd3d Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of CD3D mRNA CTD PMID:22061828 Cd3d Rat hexachlorobenzene decreases expression EXP 6480464 Hexachlorobenzene results in decreased expression of CD3D mRNA CTD PMID:15159207 Cd3d Rat hydroxychloroquine multiple interactions ISO CD3D (Homo sapiens) 6480464 [Hydroxychloroquine co-treated with Methotrexate co-treated with Sulfasalazine] results in decreased expression of CD3D mRNA CTD PMID:28863153 Cd3d Rat isotretinoin increases expression ISO CD3D (Homo sapiens) 6480464 Isotretinoin results in increased expression of CD3D mRNA CTD PMID:20436886 Cd3d Rat ketoconazole multiple interactions ISO CD3D (Homo sapiens) 6480464 Ketoconazole inhibits the reaction [[[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased abundance of Calcitriol] and Ketoconazole inhibits the reaction [Calcifediol promotes the reaction [[[CD3G protein binds to CD3D protein binds to CD3E protein binds to CD247 protein] which co-treated with CD28 protein] results in increased expression of VDR protein]] CTD PMID:24792400 Cd3d Rat methamphetamine multiple interactions ISO CD3D (Homo sapiens) 6480464 CDK5 protein affects the reaction [Methamphetamine results in increased expression of CD3D protein] CTD PMID:29705343 Cd3d Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of CD3D protein CTD PMID:29705343 Cd3d Rat methamphetamine increases expression ISO CD3D (Homo sapiens) 6480464 Methamphetamine results in increased expression of CD3D protein CTD PMID:29705343 Cd3d Rat methamphetamine multiple interactions EXP 6480464 CDK5 protein affects the reaction [Methamphetamine results in increased expression of CD3D protein] CTD PMID:29705343 Cd3d Rat methotrexate multiple interactions ISO CD3D (Homo sapiens) 6480464 [Hydroxychloroquine co-treated with Methotrexate co-treated with Sulfasalazine] results in decreased expression of CD3D mRNA CTD PMID:28863153 Cd3d Rat N-Nitrosopyrrolidine increases expression ISO CD3D (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of CD3D mRNA CTD PMID:32234424 Cd3d Rat nickel atom increases expression ISO CD3D (Homo sapiens) 6480464 Nickel results in increased expression of CD3D mRNA CTD PMID:25583101 Cd3d Rat nitrobenzenes increases expression EXP 6480464 Nitrobenzenes analog results in increased expression of CD3D mRNA CTD PMID:19784758 Cd3d Rat nitroglycerin increases expression EXP 6480464 Nitroglycerin results in increased expression of CD3D mRNA CTD PMID:12102619 Cd3d Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CD3D mRNA CTD PMID:25729387 Cd3d Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of CD3D mRNA CTD PMID:25729387 Cd3d Rat ozone multiple interactions ISO Cd3d (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of CD3D mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of CD3D mRNA CTD PMID:34911549 Cd3d Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CD3D mRNA CTD PMID:19784758 Cd3d Rat paracetamol increases expression ISO CD3D (Homo sapiens) 6480464 Acetaminophen results in increased expression of CD3D mRNA CTD PMID:22230336 Cd3d Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of CD3D mRNA CTD PMID:19784758 Cd3d Rat paracetamol affects expression EXP 6480464 Acetaminophen affects the expression of CD3D mRNA CTD PMID:19784758 Cd3d Rat parathion increases expression EXP 6480464 Parathion results in increased expression of CD3D mRNA CTD PMID:19784758 Cd3d Rat phenylmercury acetate increases expression ISO CD3D (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of CD3D mRNA CTD PMID:26272509 Cd3d Rat phenylmercury acetate multiple interactions ISO CD3D (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CD3D mRNA CTD PMID:27188386 Cd3d Rat pirinixic acid decreases expression ISO Cd3d (Mus musculus) 6480464 pirinixic acid results in decreased expression of CD3D mRNA CTD PMID:17426115 Cd3d Rat quercetin increases expression ISO CD3D (Homo sapiens) 6480464 Quercetin results in increased expression of CD3D mRNA CTD PMID:21632981 Cd3d Rat SB 431542 multiple interactions ISO CD3D (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of CD3D mRNA CTD PMID:27188386 Cd3d Rat silicon dioxide increases expression ISO Cd3d (Mus musculus) 6480464 Silicon Dioxide results in increased expression of CD3D mRNA CTD PMID:29341224 Cd3d Rat sodium arsenite decreases expression ISO Cd3d (Mus musculus) 6480464 sodium arsenite results in decreased expression of CD3D mRNA CTD PMID:37682722 Cd3d Rat sulfasalazine multiple interactions ISO CD3D (Homo sapiens) 6480464 [Hydroxychloroquine co-treated with Methotrexate co-treated with Sulfasalazine] results in decreased expression of CD3D mRNA CTD PMID:28863153 Cd3d Rat tamibarotene decreases expression ISO Cd3d (Mus musculus) 6480464 tamibarotene results in decreased expression of CD3D mRNA CTD PMID:20861477 Cd3d Rat tamoxifen affects expression ISO Cd3d (Mus musculus) 6480464 Tamoxifen affects the expression of CD3D mRNA CTD PMID:17555576 Cd3d Rat testosterone increases expression ISO Cd3d (Mus musculus) 6480464 Testosterone deficiency results in increased expression of CD3D mRNA CTD PMID:33848595 Cd3d Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of CD3D mRNA CTD PMID:34492290 Cd3d Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of CD3D mRNA CTD PMID:25729387 Cd3d Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of CD3D mRNA CTD PMID:25729387 Cd3d Rat Tributyltin oxide decreases expression EXP 6480464 bis(tri-n-butyltin)oxide results in decreased expression of CD3D mRNA CTD PMID:17553608 Cd3d Rat valproic acid decreases methylation ISO CD3D (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of CD3D gene CTD PMID:29154799 Cd3d Rat valproic acid increases expression ISO CD3D (Homo sapiens) 6480464 Valproic Acid results in increased expression of CD3D mRNA CTD PMID:28001369 Cd3d Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of CD3D mRNA CTD PMID:23869203
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,6-di-tert-butyl-4-methylphenol (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4-hydroxyphenyl retinamide (ISO) 7,12-dimethyltetraphene (EXP) acetamide (EXP) aflatoxin B1 (ISO) all-trans-retinoic acid (ISO) alpha-Zearalanol (EXP) ammonium chloride (EXP) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (EXP) benzene (ISO) benzo[a]pyrene (ISO) benzo[b]fluoranthene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcidiol (ISO) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloroprene (ISO) chlorpyrifos (ISO) clofibrate (ISO) copper(II) sulfate (ISO) cyclophosphamide (ISO) dexamethasone (ISO) diethylstilbestrol (ISO) diuron (ISO) dorsomorphin (ISO) furan (EXP) gentamycin (EXP) hexachlorobenzene (EXP) hydroxychloroquine (ISO) isotretinoin (ISO) ketoconazole (ISO) methamphetamine (EXP,ISO) methotrexate (ISO) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) nitrobenzenes (EXP) nitroglycerin (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) parathion (EXP) phenylmercury acetate (ISO) pirinixic acid (ISO) quercetin (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) sulfasalazine (ISO) tamibarotene (ISO) tamoxifen (ISO) testosterone (ISO) thioacetamide (EXP) topotecan (EXP) Tributyltin oxide (EXP) valproic acid (ISO) vinclozolin (EXP)
1.
Initiation of TCR signaling: regulation within CD3 dimers.
Alarcon B, etal., Immunol Rev 2003 Feb;191:38-46.
2.
Effect of CD3delta deficiency on maturation of alpha/beta and gamma/delta T-cell lineages in severe combined immunodeficiency.
Dadi HK, etal., N Engl J Med 2003 Nov 6;349(19):1821-8.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
5.
High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.
Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
7.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
Biochemical evidence for the presence of a single CD3delta and CD3gamma chain in the surface T cell receptor/CD3 complex.
Pan Q, etal., J Biol Chem 2004 Dec 3;279(49):51068-74. Epub 2004 Sep 30.
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Comprehensive gene review and curation
RGD comprehensive gene curation
16.
Tentative Sequence Identification Numbers
Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.
Isolation and characterization of a cDNA clone encoding the murine homologue of the human 20K T3/T-cell receptor glycoprotein.
van den Elsen P, etal., Nature 1985 Apr 11-17;314(6011):542-4.
Cd3d Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 8 54,184,573 - 54,190,112 (+) NCBI GRCr8 mRatBN7.2 8 45,287,803 - 45,293,342 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 8 45,288,749 - 45,301,809 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 8 50,784,363 - 50,788,968 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 8 49,063,089 - 49,067,694 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 8 46,933,645 - 46,938,252 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 8 49,282,502 - 49,287,095 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 8 49,282,460 - 49,287,110 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 8 47,900,331 - 47,905,113 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 8 47,932,151 - 47,936,744 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 8 47,940,916 - 47,945,510 (+) NCBI Celera 8 44,873,511 - 44,878,104 (+) NCBI Celera RH 3.4 Map 8 450.1 RGD Cytogenetic Map 8 q22 NCBI
CD3D Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 118,338,954 - 118,342,705 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 118,334,537 - 118,342,705 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 118,209,669 - 118,213,420 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 117,714,999 - 117,718,669 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 11 117,710,474 - 117,718,533 NCBI Celera 11 115,367,658 - 115,371,328 (-) NCBI Celera Cytogenetic Map 11 q23.3 NCBI HuRef 11 114,143,683 - 114,147,356 (-) NCBI HuRef CHM1_1 11 118,096,225 - 118,099,892 (-) NCBI CHM1_1 T2T-CHM13v2.0 11 118,355,312 - 118,360,628 (-) NCBI T2T-CHM13v2.0
Cd3d Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 9 44,893,067 - 44,898,350 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 9 44,893,084 - 44,898,637 (+) Ensembl GRCm39 Ensembl GRCm38 9 44,981,769 - 44,987,052 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 9 44,981,786 - 44,987,339 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 9 44,789,869 - 44,795,135 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 9 44,732,876 - 44,737,416 (+) NCBI MGSCv36 mm8 Celera 9 42,246,904 - 42,252,171 (+) NCBI Celera Cytogenetic Map 9 A5.2 NCBI cM Map 9 24.84 NCBI
Cd3d Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955412 19,480,977 - 19,484,721 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955412 19,481,059 - 19,484,890 (-) NCBI ChiLan1.0 ChiLan1.0
LOC100979946 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 119,038,840 - 119,044,827 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 120,145,509 - 120,149,139 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 113,174,007 - 113,179,244 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 117,105,868 - 117,111,051 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 117,105,868 - 117,111,051 (-) Ensembl panpan1.1 panPan2
CD3D Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 5 15,392,841 - 15,396,745 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 5 15,389,243 - 15,396,750 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 5 15,443,561 - 15,447,497 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 5 15,335,138 - 15,339,065 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 5 15,331,562 - 15,339,070 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 5 15,473,389 - 15,477,325 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 5 15,376,847 - 15,380,783 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 5 15,417,998 - 15,421,934 (+) NCBI UU_Cfam_GSD_1.0
Cd3d Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 100,478,720 - 100,482,225 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936542 3,399,845 - 3,403,634 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936542 3,400,129 - 3,403,628 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CD3D Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 9 45,637,129 - 45,644,221 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 9 45,640,475 - 45,644,153 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 9 50,681,602 - 50,685,279 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CD3D Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 109,715,148 - 109,719,576 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 109,713,017 - 109,719,950 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666043 16,315,112 - 16,320,264 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cd3d
.
Predicted Target Of
Count of predictions: 25 Count of miRNA genes: 23 Interacting mature miRNAs: 25 Transcripts: ENSRNOT00000021488 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1298065 Scl16 Serum cholesterol level QTL 16 3.8 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30856404 75856404 Rat 1554321 Bmd3 Bone mineral density QTL 3 7.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 8 40952565 123900184 Rat 1578769 Uae31 Urinary albumin excretion QTL 31 3.3 0.001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 30848154 101699754 Rat 1298079 Activ2 Activity QTL 2 9.5 0.000001 voluntary movement trait (VT:0003491) rearing measurement (CMO:0001515) 8 41866876 86866876 Rat 11556286 Cm81 Cardiac mass QTL 81 0.01 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 30848154 61290444 Rat 70161 Bp62 Blood pressure QTL 62 2.9 0.001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 42692684 90165460 Rat 1578765 Klgr1 Kidney lesion grade QTL 1 3.3 0.0001 kidney morphology trait (VT:0002135) organ lesion measurement (CMO:0000677) 8 30848154 101699754 Rat 1582222 Epfw2 Epididymal fat weight QTL 2 3.2 0.0005 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 8 31737729 76737729 Rat 1354627 Despr14 Despair related QTL 14 0.0056 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 8 7688955 52688955 Rat 61464 Niddm11 Non-insulin dependent diabetes mellitus QTL 11 3.1 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 35582032 80582032 Rat 1578755 Pur5 Proteinuria QTL 5 3.3 0.0001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 8 30848154 101699754 Rat 1300146 Rf17 Renal function QTL 17 2.9 renal blood flow trait (VT:2000006) absolute change in renal blood flow rate (CMO:0001168) 8 28242912 73242912 Rat 8662823 Vetf5 Vascular elastic tissue fragility QTL 5 1.9 artery integrity trait (VT:0010639) patent ductus arteriosus score (CMO:0002566) 8 28242912 99525068 Rat 2313088 Bss75 Bone structure and strength QTL 75 3.1 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 8 30848154 82460899 Rat 1358896 Bp262 Blood pressure QTL 262 2.89 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 27205715 99103503 Rat 731182 Uae24 Urinary albumin excretion QTL 24 6.4 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 19331152 93965294 Rat 724514 Uae15 Urinary albumin excretion QTL 15 2.9 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 8 29502665 70386295 Rat 61353 Bp35 Blood pressure QTL 35 0.001 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 8 30848154 61290444 Rat 631842 Inf1 Infertility severity QTL 1 4.1 0.001 seminal gland mass (VT:0010524) seminal vesicle wet weight (CMO:0001603) 8 22662330 67662330 Rat 737824 Hcar10 Hepatocarcinoma resistance QTL 10 2.9 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 8 40713066 82925667 Rat 1359033 Bp273 Blood pressure QTL 273 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 61290444 Rat 1331769 Rf39 Renal function QTL 39 3.871 urine output (VT:0003620) timed urine volume (CMO:0000260) 8 41866876 75097878 Rat 61358 Bp39 Blood pressure QTL 39 2 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 35551938 80551938 Rat 1358906 Bp253 Blood pressure QTL 253 4 0.0004 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 40713066 93965294 Rat 1358907 Cm40 Cardiac mass QTL 40 1.89 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 27205715 99103503 Rat 1331744 Bp217 Blood pressure QTL 217 3.398 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 8 30848154 58482492 Rat 2316950 Scl66 Serum cholesterol level QTL 66 4.1 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 8 30848259 105647037 Rat 1358892 Kidm26 Kidney mass QTL 26 3.69 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 27205715 99103503 Rat 1359021 Bp271 Blood pressure QTL 271 1.8 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 26644912 46711092 Rat 631216 Stl9 Serum triglyceride level QTL 9 4.71 0.0001 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 8 41867010 70386132 Rat 61373 Mcs4 Mammary carcinoma susceptibility QTL 4 1.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 8 16290444 61290444 Rat 2313057 Bss76 Bone structure and strength QTL 76 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 8 30848154 82460899 Rat 12879878 Bw183 Body weight QTL 183 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 43296169 98968765 Rat 1549908 Neudeg1 Neurodegradation QTL 1 5.5 0 nervous system integrity trait (VT:0010566) logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986) 8 30188867 94457446 Rat 12879879 Cm99 Cardiac mass QTL 99 0.001 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 8 43296169 98968765 Rat 2317030 Wbc5 White blood cell count QTL 5 3.21 0.005 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 8 8736635 53736635 Rat 1331804 Cm30 Cardiac mass QTL 30 3.77443 heart mass (VT:0007028) heart wet weight (CMO:0000069) 8 28242912 53961020 Rat 2313067 Bss77 Bone structure and strength QTL 77 3.1 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 8 30848154 82460899 Rat 2317032 Ginf2 Gastrointestinal inflammation QTL 2 3.21 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 8 4705810 49705810 Rat 2301416 Bp315 Blood pressure QTL 315 0.008 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 8 7670578 52670578 Rat 12879880 Cm100 Cardiac mass QTL 100 0.001 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 43296169 98968765 Rat 12879881 Cm101 Cardiac mass QTL 101 0.001 heart right ventricle mass (VT:0007033) heart right ventricle weight to body weight ratio (CMO:0000914) 8 43296169 98968765 Rat 12879882 Am8 Aortic mass QTL 8 0.001 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 43296169 98968765 Rat 2317036 Livw3 Liver weight QTL 3 2.43 0.01 liver mass (VT:0003402) liver weight to body weight ratio (CMO:0000633) 8 4705810 49705810 Rat 12879883 Kidm65 Kidney mass QTL 65 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 8 43296169 98968765 Rat 12880023 Bw184 Body weight QTL 184 0.001 body mass (VT:0001259) body weight (CMO:0000012) 8 2097640 47097640 Rat 5684993 Bmd84 Bone mineral density QTL 84 4.1 tibia mineral mass (VT:1000283) bone mineral content (CMO:0001554) 8 42692684 50095447 Rat 12880028 Cm103 Cardiac mass QTL 103 0.02 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 8 2097640 47097640 Rat 2317051 Aia18 Adjuvant induced arthritis QTL 18 2.42 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 8 8736635 53736635 Rat 2317048 Ginf1 Gastrointestinal inflammation QTL 1 3.52 0.005 cecum mucosa thickness (VT:0010234) enterocolitis severity score (CMO:0002138) 8 4705810 49705810 Rat 12880025 Cm102 Cardiac mass QTL 102 0.044 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 8 2097640 47097640 Rat 1558646 Swd5 Spike wave discharge measurement QTL 5 3.45 0.00036 brain electrophysiology trait (VT:0010557) brain spike-and-wave discharge frequency (CMO:0001742) 8 14906751 59906751 Rat 2302278 Gluco36 Glucose level QTL 36 4.2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 29502665 50095447 Rat 12880044 Am9 Aortic mass QTL 9 0.007 aorta mass (VT:0002845) aorta weight to aorta length to body weight ratio (CMO:0002722) 8 2097640 47097640 Rat 631648 Stl5 Serum triglyceride level QTL 5 4 0.0003 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 27205715 54998217 Rat 1331838 Niddm61 Non-insulin dependent diabetes mellitus QTL 61 3.53 0.0004 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 8 36469535 99083736 Rat 631650 Stl6 Serum triglyceride level QTL 6 4 0.0019 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 8 10378157 112202585 Rat 1581557 Eae16 Experimental allergic encephalomyelitis QTL 16 3.8 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 8 8462195 110921472 Rat 631271 Lecl1 Lens clarity QTL 1 0.001 lens clarity trait (VT:0001304) age of onset/diagnosis of cataract (CMO:0001584) 8 18984168 84531599 Rat 2303564 Gluco43 Glucose level QTL 43 3 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 8 26130187 71130187 Rat 1598824 Memor4 Memory QTL 4 2.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 8 9712220 53356647 Rat 2313046 Bss78 Bone structure and strength QTL 78 3.5 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 8 30848154 82460899 Rat 1354595 Despr4 Despair related QTL 4 2.16 0.0036 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 8 7688955 52688955 Rat 2303572 Insul13 Insulin level QTL 13 2 blood insulin amount (VT:0001560) blood insulin level (CMO:0000349) 8 26130187 71130187 Rat
RH94582
Rat Assembly Chr Position (strand) Source JBrowse RH 3.4 Map 8 450.1 UniSTS Cytogenetic Map 8 q22 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
9
29
53
85
85
54
25
54
6
179
73
34
35
57
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000021488 ⟹ ENSRNOP00000021489
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 8 45,288,749 - 45,301,809 (+) Ensembl Rnor_6.0 Ensembl 8 49,282,460 - 49,287,110 (+) Ensembl
RefSeq Acc Id:
NM_013169 ⟹ NP_037301
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 54,185,519 - 54,190,112 (+) NCBI mRatBN7.2 8 45,288,749 - 45,293,342 (+) NCBI Rnor_6.0 8 49,282,502 - 49,287,095 (+) NCBI Rnor_5.0 8 47,900,331 - 47,905,113 (+) NCBI RGSC_v3.4 8 47,932,151 - 47,936,744 (+) RGD Celera 8 44,873,511 - 44,878,104 (+) RGD
Sequence:
GCTCACCCAGGCTGGTCGTCCGGTGACTTGCCTCTACTCCGTGGATGAGTCCCTGTGGAAGATGGAGCACTATGGAATTCTGGTTAGTCTGCTACTGGCTACTGTTCTCCCCCAAGGGAGCCCCTTCA
hide sequence
RefSeq Acc Id:
XM_039080903 ⟹ XP_038936831
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 8 54,184,573 - 54,190,109 (+) NCBI mRatBN7.2 8 45,287,803 - 45,293,335 (+) NCBI
RefSeq Acc Id:
NP_037301 ⟸ NM_013169
- Peptide Label:
precursor
- UniProtKB:
P19377 (UniProtKB/Swiss-Prot), A6J422 (UniProtKB/TrEMBL), A0A8L2QB67 (UniProtKB/TrEMBL)
- Sequence:
MEHYGILVSLLLATVLPQGSPFKIEVVEYEDKVFVNCNTSIRHLDGSVERWLTKNKSLILGKGILDPRGMYMCNGTEELAKEVSTVQVYYRMCQNCVELDSATLAGVIITDLIATLLLALGVYCFAGH
hide sequence
Ensembl Acc Id:
ENSRNOP00000021489 ⟸ ENSRNOT00000021488
RefSeq Acc Id:
XP_038936831 ⟸ XM_039080903
- Peptide Label:
isoform X1
RGD ID: 13695907 Promoter ID: EPDNEW_R6432 Type: initiation region Name: Cd3d_1 Description: CD3d molecule SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 8 49,282,502 - 49,282,562 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-03-14
Cd3d
CD3 delta subunit of T-cell receptor complex
Cd3d
CD3d molecule
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-02-02
Cd3d
CD3d molecule
Cd3d
CD3 molecule, delta
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-06-27
Cd3d
CD3 molecule delta polypeptide
Cd3d
CD3 antigen delta polypeptide
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2002-06-10
Cd3d
CD3 antigen delta polypeptide
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_function
human homolog is a component of the antigen receptor on T cells
634716
