C8b (complement C8 beta chain) - Rat Genome Database

Advanced Search (OLGA)

Gene: C8b (complement C8 beta chain) Rattus norvegicus

Analyze

Symbol:

C8b

Name:

complement C8 beta chain

RGD ID:

2239

Description:

Predicted to enable metal ion binding activity. Predicted to be involved in complement activation, GZMK pathway. Located in extracellular space. Biomarker of myocardial infarction. Human ortholog(s) of this gene implicated in type II complement component 8 deficiency. Orthologous to human C8B (complement C8 beta chain); PARTICIPATES IN coagulation cascade pathway; complement system pathway; Entamoebiasis pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

C8b_mapped; complement component 8 subunit beta; complement component 8, beta polypeptide; complement component 8, beta polypeptide (mapped); complement component 8, beta subunit; complement component C8 beta chain

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	C8B (complement C8 beta chain)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, PhylomeDB, Treefam
Mus musculus (house mouse):	C8b (complement component 8, beta polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	C8b (complement C8 beta chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	C8B (complement C8 beta chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	C8B (complement C8 beta chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	C8b (complement C8 beta chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	C8B (complement C8 beta chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	C8B (complement C8 beta chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	C8b (complement C8 beta chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	C8b (complement C8 beta chain)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GINM1 (glycosylated integral membrane protein 1)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	C8b (complement component 8, beta polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	C8B (complement C8 beta chain)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	c8b (complement component 8, beta polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	c8b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	124,763,974 - 124,801,522 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	124,761,790 - 124,801,516 (+)	Ensembl				GRCr8
mRatBN7.2	5	119,535,009 - 119,572,565 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	119,535,146 - 119,572,565 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	122,158,666 - 122,198,410 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	123,884,033 - 123,923,771 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	123,935,279 - 123,975,017 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	124,298,269 - 124,338,055 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	124,300,477 - 124,338,053 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	128,157,620 - 128,196,920 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	125,728,606 - 125,766,093 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	118,092,231 - 118,129,546 (+)	NCBI		Celera
Cytogenetic Map	5	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

complement component 6 deficiency (ISO)

genetic disease (ISO)

juvenile rheumatoid arthritis (ISO)

meningitis (ISO)

myocardial infarction (IEP)

Neisseriaceae Infections (ISO)

primary immunodeficiency disease (ISO)

type II complement component 8 deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

amiodarone (EXP,ISO)

ammonium chloride (EXP)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP)

buta-1,3-diene (ISO)

cadmium dichloride (EXP)

clofibrate (EXP)

cobalt dichloride (EXP)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dichloroacetic acid (ISO)

epoxiconazole (ISO)

ethanol (EXP)

flutamide (EXP)

furan (EXP)

inulin (ISO)

L-ethionine (EXP)

methapyrilene (EXP)

methotrexate (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-Nitrosopyrrolidine (ISO)

nefazodone (EXP)

nickel atom (ISO)

nickel dichloride (EXP)

nimesulide (EXP)

nitrofen (EXP)

O-methyleugenol (ISO)

okadaic acid (ISO)

omeprazole (EXP)

paracetamol (ISO)

parathion (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

pirinixic acid (EXP,ISO)

quercetin (ISO)

sodium arsenite (ISO)

sodium dichromate (EXP)

sodium fluoride (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

complement activation (IBA,IEA,ISO,ISS)

complement activation, alternative pathway (IEA)

complement activation, classical pathway (IEA)

complement activation, GZMK pathway (IEA,ISO,ISS)

immune response (IEA)

immune system process (IEA)

innate immune response (IEA)

killing of cells of another organism (IEA,ISO)

transmembrane transport (IEA)

Cellular Component

extracellular region (IDA,IEA)

extracellular space (IBA,IDA)

membrane attack complex (IBA,IEA,ISO,ISS)

other organism cell membrane (IEA,ISO,ISS)

plasma membrane (IEA,ISO)

Molecular Function

metal ion binding (IEA)

protein-containing complex binding (IPI)

wide pore channel activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

coagulation cascade pathway (IEA)

complement system pathway (IEA)

Entamoebiasis pathway (IEA)

prion disease pathway (IEA)

systemic lupus erythematosus pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Binding of human and rat CD59 to the terminal complement complexes.	Lehto T, etal., Immunology. 1997 Jan;90(1):121-8.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Membrane attack complex contributes to destruction of vascular integrity in acute lung allograft rejection.	Nakashima S, etal., J Immunol 2002 Oct 15;169(8):4620-7.
5.	The membrane attack complex of complement induces caspase activation and apoptosis.	Nauta AJ, etal., Eur J Immunol 2002 Mar;32(3):783-92.
6.	Biosynthesis of C8 by hepatocytes. Differential expression and intracellular association of the alpha-gamma- and beta-subunits.	Ng SC and Sodetz JM, J Immunol. 1987 Nov 1;139(9):3021-7.
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	CD59 homologue regulates complement-dependent cytolysis of rat Schwann cells.	Sawant-Mane S, etal., J Neuroimmunol. 1996 Sep;69(1-2):63-71.
13.	Time course of complement activation and inhibitor expression after ischemic injury of rat myocardium.	Vakeva A, etal., Am J Pathol. 1994 Jun;144(6):1357-68.
14.	Formation of complement membrane attack complex in mammalian cerebral cortex evokes seizures and neurodegeneration.	Xiong ZQ, etal., J Neurosci. 2003 Feb 1;23(3):955-60.

Additional References at PubMed

PMID:7665162	PMID:12477932	PMID:22832194	PMID:23533145	PMID:24769233

Genomics

Comparative Map Data

C8b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	124,763,974 - 124,801,522 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	124,761,790 - 124,801,516 (+)	Ensembl				GRCr8
mRatBN7.2	5	119,535,009 - 119,572,565 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	119,535,146 - 119,572,565 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	122,158,666 - 122,198,410 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	123,884,033 - 123,923,771 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	123,935,279 - 123,975,017 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	124,298,269 - 124,338,055 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	124,300,477 - 124,338,053 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	128,157,620 - 128,196,920 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	125,728,606 - 125,766,093 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	118,092,231 - 118,129,546 (+)	NCBI		Celera
Cytogenetic Map	5	q34	NCBI

C8B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	56,929,207 - 56,966,015 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	56,929,099 - 56,974,383 (-)	Ensembl			hg38	GRCh38
GRCh37	1	57,394,880 - 57,431,688 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	57,167,471 - 57,204,276 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	57,106,905 - 57,143,670	NCBI
Celera	1	55,679,648 - 55,716,484 (-)	NCBI		Celera
Cytogenetic Map	1	p32.2	NCBI
HuRef	1	55,507,178 - 55,544,141 (-)	NCBI		HuRef
CHM1_1	1	57,510,118 - 57,547,015 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	56,807,996 - 56,844,833 (-)	NCBI		T2T-CHM13v2.0

C8b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	104,623,514 - 104,661,745 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	104,623,514 - 104,661,745 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	104,766,317 - 104,804,548 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	104,766,317 - 104,804,548 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	104,438,922 - 104,477,153 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	104,264,249 - 104,302,480 (+)	NCBI		MGSCv36	mm8
Celera	4	103,118,327 - 103,156,421 (+)	NCBI		Celera
Cytogenetic Map	4	C6	NCBI
cM Map	4	48.61	NCBI

C8b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955464	2,754,655 - 2,796,423 (+)	NCBI	ChiLan1.0	ChiLan1.0

C8B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	169,859,881 - 169,896,727 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	169,012,186 - 169,049,027 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	56,213,618 - 56,250,488 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	57,923,720 - 57,960,674 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	57,923,720 - 57,960,674 (-)	Ensembl			panPan2	panpan1.1

C8B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	52,535,359 - 52,574,872 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	52,532,481 - 52,574,182 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	52,603,051 - 52,642,024 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	52,722,538 - 52,761,347 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	52,722,355 - 52,761,221 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	52,666,856 - 52,705,559 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	52,613,006 - 52,651,475 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	52,897,315 - 52,936,322 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

C8b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	70,742,662 - 70,778,205 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936522	4,644,047 - 4,673,615 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936522	4,638,111 - 4,673,388 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

C8B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	155,387,145 - 155,453,438 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	155,411,982 - 155,453,034 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	143,164,801 - 143,205,861 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

C8B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	75,996,626 - 76,034,395 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	75,996,823 - 76,035,292 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	41,262,435 - 41,300,129 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

C8b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624862	3,187,120 - 3,225,751 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624862	3,187,573 - 3,224,895 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

C8b
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	49,804,587 - 49,842,056 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in C8b
75 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	95
Count of miRNA genes:	70
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000010100
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	102105698	152749382	Rat
2303586	Gluco52	Glucose level QTL 52	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	100826632	145826632	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	44924861	153890773	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	38207390	136631402	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	84630798	129630798	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	48523123	134369373	Rat
1582230	Bw78	Body weight QTL 78	3.2	0.0016	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	124314582	133270832	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	84630798	129630798	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	92583776	137583776	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	98972960	143972960	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	92583776	137583776	Rat
2303618	Vencon1	Ventilatory control QTL 1	3.8		respiration trait (VT:0001943)	oxygen consumption (CMO:0002169)	5	100826632	145826632	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84630798	129630798	Rat
7394710	Emca12	Estrogen-induced mammary cancer QTL 12			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	94034903	139034903	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	95062526	133270832	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	60601597	137492949	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	36460764	136631402	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
1600362	Mcs19	Mammary carcinoma susceptibility QTL 19	2.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	82032155	127032155	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	89369373	134369373	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	70969494	136328156	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	97492524	133270832	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	92881678	137881678	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	95062526	133270832	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	104262817	153890625	Rat

Markers in Region

D5Rhm3

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	119,564,714 - 119,564,847 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	124,330,147 - 124,330,281	NCBI	Rnor6.0
Rnor_5.0	5	128,189,012 - 128,189,146	UniSTS	Rnor5.0
RGSC_v3.4	5	125,758,243 - 125,758,375	UniSTS	RGSC3.4
Celera	5	118,121,696 - 118,121,828	UniSTS
Cytogenetic Map	5	q34	UniSTS

D5Rhm4

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	119,592,239 - 119,592,384 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	124,357,602 - 124,357,746	NCBI	Rnor6.0
Rnor_5.0	5	128,216,270 - 128,216,414	UniSTS	Rnor5.0
RGSC_v3.4	5	125,785,615 - 125,785,759	UniSTS	RGSC3.4
Celera	5	118,149,222 - 118,149,370	UniSTS
Cytogenetic Map	5	q34	UniSTS

D5Rat198

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	119,536,444 - 119,536,604 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	124,301,847 - 124,302,004	NCBI	Rnor6.0
Rnor_5.0	5	128,161,162 - 128,161,319	UniSTS	Rnor5.0
RGSC_v3.4	5	125,729,894 - 125,730,051	UniSTS	RGSC3.4
RGSC_v3.4	5	125,729,893 - 125,730,051	RGD	RGSC3.4
Celera	5	118,093,519 - 118,093,676	UniSTS
RGSC_v3.1	5	125,735,119 - 125,735,277	RGD
RH 2.0 Map	5	568.8	RGD
SHRSP x BN Map	5	64.9299	RGD
Cytogenetic Map	5	q34	UniSTS

RH133281

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	119,571,960 - 119,572,158 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	124,337,451 - 124,337,648	NCBI	Rnor6.0
Rnor_5.0	5	128,196,316 - 128,196,513	UniSTS	Rnor5.0
RGSC_v3.4	5	125,765,489 - 125,765,686	UniSTS	RGSC3.4
Celera	5	118,128,942 - 118,129,139	UniSTS
RH 3.4 Map	5	716.4	UniSTS
Cytogenetic Map	5	q34	UniSTS

RH142430

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	119,571,929 - 119,572,144 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	124,337,420 - 124,337,634	NCBI	Rnor6.0
Rnor_5.0	5	128,196,285 - 128,196,499	UniSTS	Rnor5.0
RGSC_v3.4	5	125,765,458 - 125,765,672	UniSTS	RGSC3.4
Celera	5	118,128,911 - 118,129,125	UniSTS
Cytogenetic Map	5	q34	UniSTS

GDB:352688

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	119,547,438 - 119,547,547 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	124,312,871 - 124,312,979	NCBI	Rnor6.0
Rnor_5.0	5	128,171,736 - 128,171,844	UniSTS	Rnor5.0
RGSC_v3.4	5	125,740,967 - 125,741,075	UniSTS	RGSC3.4
Celera	5	118,104,512 - 118,104,620	UniSTS
Cytogenetic Map	5	q34	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
1	8	12	63	79	78	59	16	59	2	172	41	1	50	63	40	19	4	4

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001191759	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238495	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC090023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211372	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U20194	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000010100 ⟹ ENSRNOP00000010100

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	124,761,790 - 124,801,516 (+)	Ensembl
mRatBN7.2 Ensembl	5	119,535,146 - 119,572,565 (+)	Ensembl
Rnor_6.0 Ensembl	5	124,300,477 - 124,338,053 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000101013 ⟹ ENSRNOP00000095968

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	124,761,790 - 124,801,516 (+)	Ensembl
mRatBN7.2 Ensembl	5	119,535,146 - 119,572,565 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112276 ⟹ ENSRNOP00000084024

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	119,535,146 - 119,570,103 (+)	Ensembl

RefSeq Acc Id:

NM_001191759 ⟹ NP_001178688

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	124,764,114 - 124,801,522 (+)	NCBI
mRatBN7.2	5	119,535,157 - 119,572,565 (+)	NCBI
Rnor_6.0	5	124,300,559 - 124,338,055 (+)	NCBI
Rnor_5.0	5	128,157,620 - 128,196,920 (+)	NCBI
Celera	5	118,092,231 - 118,129,546 (+)	NCBI

Sequence:

show sequence

ATGAAGACAGGGGCCCAGGTTTGGAGGGCACTGGCAAAGTCATGTCTTCTTTGTGCTGCCCTTG
GATGTCTCCATCTCCCTGGTGCAAGAGGTGAGAAGCCAGATTTCTTTGAGACAAATGCAGTCAA
TGGAAGCCTTGTTAGGAGCAGACCAGTACGGAGTGTGGATGTCACCCCAGCACCTACTGACTGT
CAACTATCCACCTGGTCCTCCTGGACTGCATGTGACCCCTGTCAGAAGAAAAGGTACAGACACA
CTTACTTGCTCCGGCCCTCTCAGTTCTATGGGGAACTGTGTGACTTCTCCGACAAGGAAGTTGA
AGACTGTGTTACCAACCGAGCCTGCAGAAGTCAAGTACGATGTGAAGGCTTTGTGTGTGCACAG
ACAGGGAGGTGTGTGAATCGCAGACTCCTCTGCAATGGAGACAATGACTGTGGAGACCAATCAG
ATGAAGCCAACTGTAGGAGGATTTATAAAAAATGCTCACAGGATATGGAACAGTACTGGGCAAT
TGGCAATCTGGCCAGCGGGATAAATCTGTTCACGAACACTTTTGAGGGCCCAGTTCTCGATCAC
CGGTATTATGCTGGCGCTTGCTCCCCCCACTACATCCTGAACACCAATTTTAGGAAGCCATACA
ACGTAGAGAGCTACACCCCACAGACCCAAGGCAAATATGAATTTGCACTTACAGAATATGAATC
CTATTTCGATTTTGAACATAATGTGACAGAAAAAGCAACCAGCAAGTCTAGTTTCAAGTTTGGT
TTTAAACTGGATGGCCTGGTTGAGTTTGGAGTGAGAAAAGAAAGCAACGAGGGCAGACATTACA
TTAGCAGAACCAAACGGTTCTCCCACACTAAAAGCAAGTTTCTGCACGCGCGCTCTGTCCTTGA
AGTGGCGCATTACAAGCTGAAGTCCAGACAGCTCATGCTCCATTACGAATTCCTTCAGAGGGTC
AAGAGCCTGCCCCTGGAGTACAGCTATGGAGAATACCGAGATCTCCTTCGTGACTTTGGGACCC
ATTTCATCACCGAAGCCGTGCTTGGGGGCATCTACGAGTACACGCTTATCATGAACAAAGACGC
CATGGAGCGAGGAGATTACACTCTGGACCATGTTTCAGCCTGTGCCGGAGGAGGTTTCCAGATT
GGTGGTAACGTCTATAAAGTCTACCTCAAATTGGGTGTGTCCGAAAAGAAATGCAGTGACATTC
TGAATGAAATCAAAGACAGAAATAAGAGACGCACCATGGTAGAAGACTTGGTAGTTCTTGTGCG
AGGAGGGACAAGTGAGTACATCACCTCCTTGGCATACAAGGATCTGCCAACAGCAGAGCTGATG
AAGGAATGGGGCGATGCTGTGCAGTACAACCCAGCCATCATCAAGCTCAAGGCTGAGCCCCTGT
ATGAACTTGTGACAGCCACAGACTTTGCGTACTCCAGCACAGTGAAACAGAACATGAAGAAGGC
CCTAGAAGAATTCCAGATGGAGGTCAGCTCCTGCCGCTGTGCTCCGTGCAGGAACAATGGAGTC
CCCATCCTGAAAGAATCCCGCTGTGAGTGCATCTGTCCTGCTGGCTTCCAAGGTGTAGCCTGTG
AGGTCACCAATCGGAAAGATATCCCCATAGATGGGAAGTGGAGTTGCTGGTCTGACTGGTCTCC
ATGCTCTGGAGGACGCAAAACAAGACAAAGGCAGTGCAACAACCCGGCACCTCAGAGAGGAGGC
AGCCCCTGCTCAGGTCCTGCTTCAGAAACACTCGACTGTTAAAGGGAGGGAACACAGCCGGCAG
GTGATCAGCAGGGCTCTAACCCTCTCACACTTAGCCAGGCTTTAGCACACCAGCTCCCACCCAG
GGCTACCACAACAAAAAGCAATGCCACTCTGCCCTTTAAAGGCTTTAGTTTCTTCAGTGCATGT
TAATTCCAGTAAACAGTGGGTGGAGCAAAACCCTAAGTCCTTGCATGGTGAAACTCCCTTTGCT
CACTGCACTTTTGTTACCGTCCCATGGTCCGGGAGCCAGAAACTTTCTTGGTCACCATGGGTCA
CCATGTAGTGACAAAGGCACATAGTAGGTGTTGAATTATGAAGCAGTAAATTGATAAGAAGCTG
TTCATCCCTTGGTAAGCACAGAGTGTTCTTCAGTAATAAAGACAGCCAATCTCGATAAAAATGA
TCTTCTGTGTGCCACCAATCCATCCCCCATGACAACCTTGCAAGACAAATATCTGGGAAACAGG
CTTGGGGGATATAATGACTTGTCCCAGGTCATACAATTAGGAAATGCCAGAATTGTGCAGCCAA
CAAGGCTCTGGATTCGATGAGGCTCGTCTTTTTCTGAATGAGCGTGCAGTTAGCAAAGAATTGT
TCATGGAATAAAACGCAACAGAAAGCC

hide sequence

RefSeq Acc Id:

XM_039109958 ⟹ XP_038965886

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	124,763,974 - 124,783,122 (+)	NCBI
mRatBN7.2	5	119,535,009 - 119,554,138 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001178688	(Get FASTA)	NCBI Sequence Viewer
	XP_038965886	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA82890	(Get FASTA)	NCBI Sequence Viewer
	AAH90023	(Get FASTA)	NCBI Sequence Viewer
	EDL97879	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000010100
	ENSRNOP00000010100.5
GenBank Protein	P55314	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001178688 ⟸ NM_001191759
- Peptide Label:	precursor
- UniProtKB:	Q5EB58 (UniProtKB/Swiss-Prot), P55314 (UniProtKB/Swiss-Prot), A0A8I5ZWX9 (UniProtKB/TrEMBL), A6JRT7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKTGAQVWRALAKSCLLCAALGCLHLPGARGEKPDFFETNAVNGSLVRSRPVRSVDVTPAPTDC QLSTWSSWTACDPCQKKRYRHTYLLRPSQFYGELCDFSDKEVEDCVTNRACRSQVRCEGFVCAQ TGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCSQDMEQYWAIGNLASGINLFTNTFEGPVLDH RYYAGACSPHYILNTNFRKPYNVESYTPQTQGKYEFALTEYESYFDFEHNVTEKATSKSSFKFG FKLDGLVEFGVRKESNEGRHYISRTKRFSHTKSKFLHARSVLEVAHYKLKSRQLMLHYEFLQRV KSLPLEYSYGEYRDLLRDFGTHFITEAVLGGIYEYTLIMNKDAMERGDYTLDHVSACAGGGFQI GGNVYKVYLKLGVSEKKCSDILNEIKDRNKRRTMVEDLVVLVRGGTSEYITSLAYKDLPTAELM KEWGDAVQYNPAIIKLKAEPLYELVTATDFAYSSTVKQNMKKALEEFQMEVSSCRCAPCRNNGV PILKESRCECICPAGFQGVACEVTNRKDIPIDGKWSCWSDWSPCSGGRKTRQRQCNNPAPQRGG SPCSGPASETLDC hide sequence

Ensembl Acc Id:

ENSRNOP00000010100 ⟸ ENSRNOT00000010100

RefSeq Acc Id:	XP_038965886 ⟸ XM_039109958
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000084024 ⟸ ENSRNOT00000112276

Ensembl Acc Id:

ENSRNOP00000095968 ⟸ ENSRNOT00000101013

Protein Domains

EGF-like LDL-receptor class A MACPF TSP type-1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P55314-F1-model_v2	AlphaFold	P55314	1-589	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693870

Promoter ID:

EPDNEW_R4395

Type:

initiation region

Name:

C8b_1

Description:

complement C8 beta chain

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	124,300,533 - 124,300,593	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2239	AgrOrtholog
BioCyc Gene	G2FUF-40492	BioCyc
Ensembl Genes	ENSRNOG00000007639	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000010100	ENTREZGENE
	ENSRNOT00000010100.8	UniProtKB/Swiss-Prot
Gene3D-CATH	2.20.100.10	UniProtKB/Swiss-Prot
	4.10.400.10	UniProtKB/Swiss-Prot
	Laminin	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7326160	IMAGE-MGC_LOAD
InterPro	C8A_B_C6_EGF-like	UniProtKB/Swiss-Prot
	EGF-like_dom	UniProtKB/Swiss-Prot
	LDL_receptor-like_sf	UniProtKB/Swiss-Prot
	LDLR_class-A_CS	UniProtKB/Swiss-Prot
	LDrepeatLR_classA_rpt	UniProtKB/Swiss-Prot
	MAC_perforin	UniProtKB/Swiss-Prot
	MACPF	UniProtKB/Swiss-Prot
	MACPF_CS	UniProtKB/Swiss-Prot
	TSP1_rpt	UniProtKB/Swiss-Prot
	TSP1_rpt_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:313421	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:109564	IMAGE-MGC_LOAD
NCBI Gene	C8b	ENTREZGENE
PANTHER	COMPLEMENT COMPONENT C6	UniProtKB/Swiss-Prot
	PTHR45742:SF5	UniProtKB/Swiss-Prot
Pfam	C8A_B_C6_EGF-like	UniProtKB/Swiss-Prot
	Ldl_recept_a	UniProtKB/Swiss-Prot
	MACPF	UniProtKB/Swiss-Prot
	TSP_1	UniProtKB/Swiss-Prot
PhenoGen	C8b	PhenoGen
PRINTS	COMPLEMENTC9	UniProtKB/Swiss-Prot
	TSP1REPEAT	UniProtKB/Swiss-Prot
PROSITE	EGF_1	UniProtKB/Swiss-Prot
	EGF_2	UniProtKB/Swiss-Prot
	LDLRA_1	UniProtKB/Swiss-Prot
	LDLRA_2	UniProtKB/Swiss-Prot
	MACPF_1	UniProtKB/Swiss-Prot
	MACPF_2	UniProtKB/Swiss-Prot
	TSP1	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000007639	RatGTEx
SMART	LDLa	UniProtKB/Swiss-Prot
	MACPF	UniProtKB/Swiss-Prot
	TSP1	UniProtKB/Swiss-Prot
Superfamily-SCOP	EGF/Laminin	UniProtKB/Swiss-Prot
	SSF57424	UniProtKB/Swiss-Prot
	SSF82895	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZWX9	ENTREZGENE
	A0A8I6GLE3_RAT	UniProtKB/TrEMBL
	A6JRT7	ENTREZGENE, UniProtKB/TrEMBL
	CO8B_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5EB58	ENTREZGENE
UniProt Secondary	Q5EB58	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-08-18	C8b	complement C8 beta chain	C8b	complement component 8, beta polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-03-23	C8b	complement component 8, beta polypeptide	C8b_mapped	complement component 8, beta polypeptide (mapped)	Symbol and Name updated	1299863	APPROVED
2007-03-23	C8b_mapped	complement component 8, beta polypeptide (mapped)	C8b_retired	complement component 8, beta polypeptide (mapped)	Data merged from RGD:1597148	737654	APPROVED
2007-03-23	C8b_retired		C8b	complement component 8, beta polypeptide (mapped)	Symbol updated	1299863	PROVISIONAL
2006-11-20	C8b	complement component 8, beta polypeptide (mapped)			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-11-17	C8b_mapped	complement component 8, beta polypeptide (mapped)			Symbol and Name updated	1556543	APPROVED
2002-06-10	C8b	Complement component 8, beta polypeptide			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)