Symbol:
Amh
Name:
anti-Mullerian hormone
RGD ID:
2108
Description:
Enables transforming growth factor beta receptor binding activity. Involved in several processes, including negative regulation of ovarian follicle development; positive regulation of NF-kappaB transcription factor activity; and preantral ovarian follicle growth. Acts upstream of or within urogenital system development. Located in extracellular space. Human ortholog(s) of this gene implicated in disorder of sexual development; ovarian carcinoma; and persistent Mullerian duct syndrome. Orthologous to human AMH (anti-Mullerian hormone); PARTICIPATES IN cytokine mediated signaling pathway; transforming growth factor-beta superfamily mediated signaling pathway; INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 17alpha-ethynylestradiol; 17beta-estradiol.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
anti - Mullerian hormone; Anti - Mullerian hormone (Mulerian inhibiting substance); anti-Muellerian hormone; MIS; muellerian-inhibiting factor; muellerian-inhibiting substance
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
AMH (anti-Mullerian hormone) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Amh (anti-Mullerian hormone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Amh (anti-Mullerian hormone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
AMH (anti-Mullerian hormone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
AMH (anti-Mullerian hormone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Amh (anti-Mullerian hormone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
AMH (anti-Mullerian hormone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
AMH (anti-Mullerian hormone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Amh (anti-Mullerian hormone) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
ERFL (ETS repressor factor like) HGNC
OMA
Alliance orthologs 3
Mus musculus (house mouse):
Amh (anti-Mullerian hormone)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
AMH (anti-Mullerian hormone)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
amh (anti-Mullerian hormone)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
amh
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,557,451 - 9,559,867 (-) NCBI GRCr8 mRatBN7.2 7 8,906,776 - 8,909,192 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,906,836 - 8,909,282 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,785,516 - 11,787,864 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,661,021 - 13,663,369 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,527,544 - 11,529,892 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,775,155 - 11,777,503 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,775,155 - 11,777,503 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,942,870 - 11,945,218 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,417,325 - 10,419,673 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,417,324 - 10,419,673 (-) NCBI Celera 7 7,089,574 - 7,091,922 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Amh Rat (-)-epigallocatechin 3-gallate multiple interactions ISO AMH (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of AMH mRNA CTD PMID:22079256 Amh Rat 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane increases expression EXP 6480464 2 more ... CTD PMID:17170213 Amh Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of AMH mRNA CTD PMID:15834898 Amh Rat 17alpha-ethynylestradiol multiple interactions ISO Amh (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of AMH mRNA CTD PMID:37844793 Amh Rat 17beta-estradiol increases expression ISO AMH (Homo sapiens) 6480464 Estradiol results in increased expression of AMH mRNA CTD PMID:21826169 Amh Rat 17beta-estradiol multiple interactions EXP 6480464 Estradiol inhibits the reaction [Cisplatin results in decreased expression of AMH protein] CTD PMID:36567042 Amh Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of AMH mRNA and Estradiol results in increased expression of AMH protein CTD PMID:29055809 Amh Rat 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one multiple interactions ISO AMH (Homo sapiens) 6480464 AMH protein inhibits the reaction [Metribolone results in increased expression of KLK3 mRNA] CTD PMID:16740653 Amh Rat 17beta-hydroxy-5alpha-androstan-3-one increases secretion EXP 6480464 Dihydrotestosterone results in increased secretion of AMH protein CTD PMID:25667201 Amh Rat 17beta-hydroxy-5alpha-androstan-3-one multiple interactions EXP 6480464 resveratrol inhibits the reaction [Dihydrotestosterone results in increased secretion of AMH protein] CTD PMID:25667201 Amh Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions ISO Amh (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Amh Rat 2,2',5,5'-tetrachlorobiphenyl multiple interactions ISO Amh (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Amh Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of AMH mRNA CTD PMID:15590112 and PMID:32109520 Amh Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of AMH mRNA CTD PMID:32234510 Amh Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of AMH protein CTD PMID:32234510 Amh Rat 2-methylcholine affects expression ISO AMH (Homo sapiens) 6480464 beta-methylcholine affects the expression of AMH mRNA CTD PMID:21179406 Amh Rat 3,3',4,4',5-pentachlorobiphenyl decreases secretion EXP 6480464 3 more ... CTD PMID:34256052 Amh Rat 3,3',5-triiodo-L-thyronine multiple interactions EXP 6480464 Triiodothyronine affects the reaction [Propylthiouracil affects the expression of AMH mRNA] CTD PMID:7819453 Amh Rat 4-nonylphenol decreases expression ISO Amh (Mus musculus) 6480464 4-nonylphenol analog results in decreased expression of AMH mRNA CTD PMID:27086933 Amh Rat 4-vinylcyclohexene dioxide decreases expression EXP 6480464 4-vinyl-1-cyclohexene dioxide results in decreased expression of AMH mRNA and 4-vinyl-1-cyclohexene dioxide results in decreased expression of AMH protein CTD PMID:20816688 more ... Amh Rat 4-vinylcyclohexene dioxide multiple interactions EXP 6480464 [butylbenzyl phthalate co-treated with 4-vinyl-1-cyclohexene dioxide] results in decreased expression of AMH mRNA more ... CTD PMID:29969652 Amh Rat 5-aza-2'-deoxycytidine decreases expression ISO AMH (Homo sapiens) 6480464 Decitabine results in decreased expression of AMH mRNA CTD PMID:19363521 Amh Rat 5-aza-2'-deoxycytidine increases expression ISO Amh (Mus musculus) 6480464 Decitabine results in increased expression of AMH mRNA CTD PMID:27915011 Amh Rat 5-aza-2'-deoxycytidine multiple interactions ISO AMH (Homo sapiens) 6480464 TP53 protein affects the reaction [Decitabine results in decreased expression of AMH mRNA] CTD PMID:19363521 Amh Rat 6-propyl-2-thiouracil multiple interactions ISO Amh (Mus musculus) 6480464 AKT1 protein mutant form promotes the reaction [Propylthiouracil results in increased expression of AMH mRNA] CTD PMID:20951798 Amh Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of AMH mRNA CTD PMID:25825206 and PMID:30047161 Amh Rat 6-propyl-2-thiouracil multiple interactions EXP 6480464 Thyroxine affects the reaction [Propylthiouracil affects the expression of AMH mRNA] and Triiodothyronine affects the reaction [Propylthiouracil affects the expression of AMH mRNA] CTD PMID:7819453 Amh Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of AMH mRNA CTD PMID:7819453 Amh Rat 6-propyl-2-thiouracil increases expression ISO Amh (Mus musculus) 6480464 Propylthiouracil results in increased expression of AMH mRNA CTD PMID:20951798 Amh Rat all-trans-retinoic acid multiple interactions ISO Amh (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of AMH mRNA CTD PMID:36189433 Amh Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of AMH mRNA and [fenvalerate co-treated with Allethrins co-treated with cypermethrin co-treated with decamethrin co-treated with cyhalothrin] results in decreased expression of AMH mRNA CTD PMID:34896426 and PMID:36053783 Amh Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of AMH mRNA CTD PMID:30047161 Amh Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of AMH mRNA CTD PMID:16483693 Amh Rat amoxicillin increases expression ISO Amh (Mus musculus) 6480464 Amoxicillin results in increased expression of AMH mRNA CTD PMID:36529298 Amh Rat aristolochic acid A increases expression ISO AMH (Homo sapiens) 6480464 aristolochic acid I results in increased expression of AMH mRNA CTD PMID:33212167 Amh Rat benzo[a]pyrene multiple interactions ISO Amh (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to AMH promoter] CTD PMID:19654925 Amh Rat benzo[a]pyrene increases methylation ISO AMH (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of AMH 5' UTR CTD PMID:27901495 Amh Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with 4-vinyl-1-cyclohexene dioxide] results in decreased expression of AMH mRNA more ... CTD PMID:25031359 more ... Amh Rat bis(2-ethylhexyl) phthalate increases expression ISO Amh (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of AMH mRNA CTD PMID:33754040 Amh Rat bis(2-ethylhexyl) phthalate decreases secretion EXP 6480464 Diethylhexyl Phthalate results in decreased secretion of AMH protein CTD PMID:37560165 Amh Rat bis(2-ethylhexyl) phthalate decreases expression ISO Amh (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of AMH mRNA and Diethylhexyl Phthalate results in decreased expression of AMH protein CTD PMID:28123099 and PMID:36774801 Amh Rat bis(2-ethylhexyl) phthalate multiple interactions ISO Amh (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate] results in decreased expression of AMH mRNA and [bisphenol A co-treated with Diethylhexyl Phthalate] results in decreased expression of AMH protein CTD PMID:22828881 Amh Rat bisphenol A increases expression ISO AMH (Homo sapiens) 6480464 bisphenol A results in increased expression of AMH mRNA CTD PMID:21826169 Amh Rat bisphenol A decreases methylation ISO Amh (Mus musculus) 6480464 bisphenol A results in decreased methylation of AMH promoter CTD PMID:33718757 Amh Rat bisphenol A decreases expression ISO AMH (Homo sapiens) 6480464 bisphenol A results in decreased expression of AMH mRNA CTD PMID:33670352 Amh Rat bisphenol A multiple interactions EXP 6480464 bisphenol A inhibits the reaction [Melatonin results in increased expression of AMH mRNA] CTD PMID:33967032 Amh Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of AMH mRNA and bisphenol A results in decreased expression of AMH protein CTD PMID:30557795 and PMID:34947998 Amh Rat bisphenol A increases expression ISO Amh (Mus musculus) 6480464 bisphenol A results in increased expression of AMH protein CTD PMID:28393075 Amh Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of AMH mRNA CTD PMID:25181051 Amh Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of AMH mRNA CTD PMID:24051130 more ... Amh Rat bisphenol A multiple interactions ISO Amh (Mus musculus) 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate] results in decreased expression of AMH mRNA and [bisphenol A co-treated with Diethylhexyl Phthalate] results in decreased expression of AMH protein CTD PMID:22828881 Amh Rat bisphenol AF decreases expression EXP 6480464 bisphenol AF results in decreased expression of AMH protein CTD PMID:27567155 Amh Rat Bisphenol B decreases expression EXP 6480464 bisphenol B results in decreased expression of AMH mRNA and bisphenol B results in decreased expression of AMH protein CTD PMID:33940105 Amh Rat butanal decreases expression ISO AMH (Homo sapiens) 6480464 butyraldehyde results in decreased expression of AMH mRNA CTD PMID:26079696 Amh Rat Butylbenzyl phthalate increases expression EXP 6480464 butylbenzyl phthalate results in increased expression of AMH mRNA and butylbenzyl phthalate results in increased expression of AMH protein CTD PMID:31319113 Amh Rat Butylbenzyl phthalate multiple interactions EXP 6480464 [butylbenzyl phthalate co-treated with 4-vinyl-1-cyclohexene dioxide] results in decreased expression of AMH mRNA more ... CTD PMID:29969652 Amh Rat Butylparaben increases expression EXP 6480464 butylparaben results in increased expression of AMH mRNA CTD PMID:22777679 and PMID:28208728 Amh Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of AMH promoter CTD PMID:22457795 Amh Rat cadmium dichloride increases expression ISO AMH (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of AMH mRNA CTD PMID:27375191 Amh Rat captan decreases expression ISO Amh (Mus musculus) 6480464 Captan results in decreased expression of AMH protein CTD PMID:34303901 Amh Rat carbamazepine decreases expression ISO AMH (Homo sapiens) 6480464 Carbamazepine results in decreased expression of AMH mRNA CTD PMID:37505509 Amh Rat carbamazepine multiple interactions ISO AMH (Homo sapiens) 6480464 [Carbamazepine co-treated with Lamotrigine] results in increased secretion of AMH protein CTD PMID:37505509 Amh Rat carbamazepine increases expression ISO AMH (Homo sapiens) 6480464 Carbamazepine results in increased expression of AMH protein CTD PMID:37505509 Amh Rat carmustine decreases expression ISO AMH (Homo sapiens) 6480464 Carmustine results in decreased expression of AMH mRNA CTD PMID:15980968 Amh Rat chlordecone increases expression ISO Amh (Mus musculus) 6480464 Chlordecone results in increased expression of AMH protein CTD PMID:31084621 Amh Rat chlorpyrifos decreases expression ISO Amh (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of AMH mRNA and Chlorpyrifos results in decreased expression of AMH protein CTD PMID:34571837 and PMID:36769379 Amh Rat cilostazol multiple interactions EXP 6480464 Cilostazol inhibits the reaction [Cyclophosphamide results in decreased expression of AMH protein] CTD PMID:32456565 Amh Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of AMH protein CTD PMID:36567042 Amh Rat cisplatin multiple interactions EXP 6480464 er-xian decoction inhibits the reaction [Cisplatin results in decreased expression of AMH protein] and Estradiol inhibits the reaction [Cisplatin results in decreased expression of AMH protein] CTD PMID:36567042 Amh Rat cisplatin decreases expression ISO AMH (Homo sapiens) 6480464 Cisplatin results in decreased expression of AMH mRNA CTD PMID:27392435 Amh Rat cocaine increases expression EXP 6480464 Cocaine results in increased expression of AMH mRNA CTD PMID:17898221 Amh Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of AMH mRNA CTD PMID:26577399 Amh Rat cyclophosphamide multiple interactions EXP 6480464 Cilostazol inhibits the reaction [Cyclophosphamide results in decreased expression of AMH protein] and Melatonin inhibits the reaction [Cyclophosphamide results in decreased expression of AMH protein] CTD PMID:32456565 and PMID:36154502 Amh Rat cyclophosphamide multiple interactions ISO Amh (Mus musculus) 6480464 Gly(14)-Humanin inhibits the reaction [Cyclophosphamide results in decreased expression of AMH protein] more ... CTD PMID:39079574 Amh Rat cyclophosphamide decreases expression ISO Amh (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of AMH protein CTD PMID:39079574 Amh Rat cyclophosphamide decreases expression EXP 6480464 Cyclophosphamide results in decreased expression of AMH protein CTD PMID:32456565 and PMID:36154502 Amh Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of AMH mRNA and [fenvalerate co-treated with Allethrins co-treated with cypermethrin co-treated with decamethrin co-treated with cyhalothrin] results in decreased expression of AMH mRNA CTD PMID:34896426 and PMID:36053783 Amh Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of AMH mRNA and [fenvalerate co-treated with Allethrins co-treated with cypermethrin co-treated with decamethrin co-treated with cyhalothrin] results in decreased expression of AMH mRNA CTD PMID:34896426 and PMID:36053783 Amh Rat cypermethrin decreases expression ISO Amh (Mus musculus) 6480464 cypermethrin results in decreased expression of AMH protein CTD PMID:35031408 Amh Rat cypermethrin decreases expression EXP 6480464 cypermethrin results in decreased expression of AMH mRNA and cypermethrin results in decreased expression of AMH protein CTD PMID:35605701 Amh Rat cypermethrin increases expression EXP 6480464 cypermethrin results in increased expression of AMH mRNA and cypermethrin results in increased expression of AMH protein CTD PMID:35102696 Amh Rat dexamethasone decreases secretion EXP 6480464 Dexamethasone results in decreased secretion of AMH protein CTD PMID:34537908 Amh Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of AMH mRNA and Dibutyl Phthalate results in increased expression of AMH protein CTD PMID:17379624 and PMID:21266533 Amh Rat dibutyl phthalate multiple interactions EXP 6480464 [butylbenzyl phthalate co-treated with Dibutyl Phthalate] results in decreased expression of AMH mRNA and Dibutyl Phthalate promotes the reaction [4-vinyl-1-cyclohexene dioxide results in decreased expression of AMH protein] CTD PMID:29969652 Amh Rat diclofenac multiple interactions ISO Amh (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of AMH mRNA CTD PMID:37844793 Amh Rat diclofenac increases expression ISO Amh (Mus musculus) 6480464 Diclofenac results in increased expression of AMH mRNA CTD PMID:35537566 Amh Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of AMH mRNA CTD PMID:35605701 Amh Rat dimethomorph decreases expression EXP 6480464 dimethomorph results in decreased expression of AMH mRNA CTD PMID:36410587 Amh Rat Ethylenethiourea decreases expression ISO Amh (Mus musculus) 6480464 Ethylenethiourea results in decreased expression of AMH protein CTD PMID:34571837 Amh Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] affects the expression of AMH mRNA and [fenvalerate co-treated with Allethrins co-treated with cypermethrin co-treated with decamethrin co-treated with cyhalothrin] results in decreased expression of AMH mRNA CTD PMID:34896426 and PMID:36053783 Amh Rat genistein multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with Genistein] results in decreased expression of AMH mRNA CTD PMID:25031359 Amh Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of AMH mRNA CTD PMID:33387578 Amh Rat ibuprofen multiple interactions ISO Amh (Mus musculus) 6480464 [Ibuprofen co-treated with hydroxyibuprofen co-treated with Diclofenac co-treated with Ethinyl Estradiol] results in decreased expression of AMH mRNA CTD PMID:37844793 Amh Rat iron dichloride decreases expression ISO AMH (Homo sapiens) 6480464 ferrous chloride results in decreased expression of AMH mRNA CTD PMID:35984750 Amh Rat ketoconazole increases expression ISO AMH (Homo sapiens) 6480464 Ketoconazole results in increased expression of AMH protein CTD PMID:16684832 Amh Rat lamotrigine multiple interactions ISO AMH (Homo sapiens) 6480464 [Carbamazepine co-treated with Lamotrigine] results in increased secretion of AMH protein CTD PMID:37505509 Amh Rat melatonin increases expression EXP 6480464 Melatonin results in increased expression of AMH mRNA CTD PMID:33967032 Amh Rat melatonin multiple interactions EXP 6480464 bisphenol A inhibits the reaction [Melatonin results in increased expression of AMH mRNA] and Melatonin inhibits the reaction [Cyclophosphamide results in decreased expression of AMH protein] CTD PMID:33967032 and PMID:36154502 Amh Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of AMH mRNA CTD PMID:30047161 Amh Rat methoxychlor increases expression EXP 6480464 Methoxychlor results in increased expression of AMH protein CTD PMID:17170213 more ... Amh Rat methylparaben decreases expression EXP 6480464 methylparaben results in decreased expression of AMH mRNA CTD PMID:22777679 Amh Rat methylparaben increases expression EXP 6480464 methylparaben results in increased expression of AMH mRNA CTD PMID:28208728 Amh Rat mono(2-ethylhexyl) phthalate decreases expression ISO AMH (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of AMH mRNA CTD PMID:19165384 Amh Rat mono(2-ethylhexyl) phthalate multiple interactions ISO Amh (Mus musculus) 6480464 [mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in decreased expression of AMH mRNA CTD PMID:36189433 Amh Rat mono(2-ethylhexyl) phthalate decreases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in decreased expression of AMH mRNA and mono-(2-ethylhexyl)phthalate results in decreased expression of AMH protein CTD PMID:19440488 and PMID:32566080 Amh Rat mono(5-carboxy-2-ethylpentyl) phthalate decreases secretion ISO AMH (Homo sapiens) 6480464 2-ethyl-5-carboxypentyl phthalate results in decreased secretion of AMH protein CTD PMID:29206197 Amh Rat monoethyl phthalate increases secretion ISO AMH (Homo sapiens) 6480464 monoethyl phthalate results in increased secretion of AMH protein CTD PMID:29206197 Amh Rat N-methyl-4-phenylpyridinium decreases expression ISO AMH (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of AMH mRNA CTD PMID:24810058 Amh Rat paclitaxel decreases expression EXP 6480464 Paclitaxel results in decreased expression of AMH mRNA CTD PMID:37949423 Amh Rat paclitaxel multiple interactions EXP 6480464 parthenolide inhibits the reaction [Paclitaxel results in decreased expression of AMH mRNA] CTD PMID:37949423 Amh Rat paracetamol decreases expression ISO AMH (Homo sapiens) 6480464 Acetaminophen results in decreased expression of AMH mRNA CTD PMID:22230336 Amh Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of AMH mRNA CTD PMID:33387578 Amh Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of AMH mRNA CTD PMID:31128353 Amh Rat parthenolide multiple interactions EXP 6480464 parthenolide inhibits the reaction [Paclitaxel results in decreased expression of AMH mRNA] CTD PMID:37949423 Amh Rat PCB138 multiple interactions ISO Amh (Mus musculus) 6480464 [2 more ... CTD PMID:25510870 Amh Rat perfluorononanoic acid increases expression EXP 6480464 perfluoro-n-nonanoic acid results in increased expression of AMH mRNA and perfluoro-n-nonanoic acid results in increased expression of AMH protein CTD PMID:20580666 Amh Rat potassium chromate multiple interactions ISO AMH (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of AMH mRNA CTD PMID:22079256 Amh Rat potassium chromate increases expression ISO AMH (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of AMH mRNA CTD PMID:22079256 Amh Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of AMH mRNA CTD PMID:30047161 Amh Rat procymidone multiple interactions EXP 6480464 [Diethylhexyl Phthalate co-treated with procymidone] results in decreased expression of AMH mRNA CTD PMID:34051340 Amh Rat propylparaben increases expression EXP 6480464 propylparaben results in increased expression of AMH mRNA CTD PMID:22777679 and PMID:28208728 Amh Rat prothioconazole decreases expression ISO AMH (Homo sapiens) 6480464 prothioconazole results in decreased expression of AMH mRNA CTD PMID:35048155 Amh Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of AMH mRNA CTD PMID:36053783 Amh Rat pyrethrins affects expression EXP 6480464 Pyrethrins affects the expression of AMH mRNA CTD PMID:34896426 Amh Rat pyrimidifen increases expression ISO AMH (Homo sapiens) 6480464 pyrimidifen results in increased expression of AMH mRNA CTD PMID:33512557 Amh Rat resmethrin increases expression ISO Amh (Mus musculus) 6480464 resmethrin results in increased expression of AMH mRNA CTD PMID:31593228 Amh Rat resveratrol multiple interactions EXP 6480464 resveratrol inhibits the reaction [Dihydrotestosterone results in increased secretion of AMH protein] CTD PMID:25667201 Amh Rat rotenone decreases expression ISO AMH (Homo sapiens) 6480464 Rotenone results in decreased expression of AMH mRNA CTD PMID:29955902 Amh Rat rotenone increases expression ISO AMH (Homo sapiens) 6480464 Rotenone results in increased expression of AMH mRNA CTD PMID:33512557 Amh Rat sodium arsenite increases expression ISO AMH (Homo sapiens) 6480464 sodium arsenite results in increased expression of AMH mRNA CTD PMID:34032870 Amh Rat sulforaphane increases expression ISO AMH (Homo sapiens) 6480464 sulforaphane results in increased expression of AMH mRNA CTD PMID:31838189 Amh Rat testosterone multiple interactions ISO Amh (Mus musculus) 6480464 AMH protein inhibits the reaction [CYP17A1 protein affects the chemical synthesis of Testosterone] CTD PMID:14630719 Amh Rat testosterone decreases expression ISO Amh (Mus musculus) 6480464 Testosterone results in decreased expression of AMH mRNA CTD PMID:22138414 Amh Rat Theaflavin 3,3'-digallate increases expression ISO Amh (Mus musculus) 6480464 theaflavin-3 and 3'-digallate results in increased expression of AMH mRNA CTD PMID:34925699 Amh Rat thiram increases expression ISO AMH (Homo sapiens) 6480464 Thiram results in increased expression of AMH mRNA CTD PMID:38568856 Amh Rat thyroxine multiple interactions EXP 6480464 Thyroxine affects the reaction [Propylthiouracil affects the expression of AMH mRNA] CTD PMID:7819453 Amh Rat titanium dioxide decreases methylation ISO Amh (Mus musculus) 6480464 titanium dioxide results in decreased methylation of AMH gene CTD PMID:35295148 Amh Rat triphenylstannane multiple interactions EXP 6480464 [triphenyltin co-treated with ethylene dimethanesulfonate] affects the expression of AMH mRNA and [triphenyltin co-treated with ethylene dimethanesulfonate] affects the expression of AMH protein CTD PMID:30772500 Amh Rat Triptolide increases expression ISO Amh (Mus musculus) 6480464 triptolide results in increased expression of AMH mRNA CTD PMID:32835833 Amh Rat triptonide increases expression ISO Amh (Mus musculus) 6480464 triptonide results in increased expression of AMH mRNA CTD PMID:33045310 Amh Rat trovafloxacin increases expression ISO Amh (Mus musculus) 6480464 trovafloxacin results in increased expression of AMH mRNA CTD PMID:35537566 Amh Rat Ulipristal increases expression EXP 6480464 ulipristal results in increased expression of AMH protein CTD PMID:38458359 Amh Rat valproic acid increases methylation ISO AMH (Homo sapiens) 6480464 Valproic Acid results in increased methylation of AMH gene CTD PMID:29154799 Amh Rat valproic acid decreases expression ISO AMH (Homo sapiens) 6480464 Valproic Acid results in decreased expression of AMH mRNA CTD PMID:37505509 Amh Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of AMH gene CTD PMID:31682807 Amh Rat vincristine decreases secretion ISO Amh (Mus musculus) 6480464 Vincristine results in decreased secretion of AMH protein CTD PMID:30657998 Amh Rat ziram increases expression EXP 6480464 Ziram results in increased expression of AMH mRNA CTD PMID:30422632 Amh Rat ziram decreases expression EXP 6480464 Ziram results in decreased expression of AMH mRNA and Ziram results in decreased expression of AMH protein CTD PMID:29627606
Imported Annotations - KEGG (archival)
(-)-epigallocatechin 3-gallate (ISO) 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP,ISO) 17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO) 17beta-hydroxy-5alpha-androstan-3-one (EXP) 2,2',4,4',5,5'-hexachlorobiphenyl (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2-methylcholine (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5-triiodo-L-thyronine (EXP) 4-nonylphenol (ISO) 4-vinylcyclohexene dioxide (EXP) 5-aza-2'-deoxycytidine (ISO) 6-propyl-2-thiouracil (EXP,ISO) all-trans-retinoic acid (ISO) allethrin (EXP) amitrole (EXP) ammonium chloride (EXP) amoxicillin (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP,ISO) bisphenol A (EXP,ISO) bisphenol AF (EXP) Bisphenol B (EXP) butanal (ISO) Butylbenzyl phthalate (EXP) Butylparaben (EXP) cadmium dichloride (EXP,ISO) captan (ISO) carbamazepine (ISO) carmustine (ISO) chlordecone (ISO) chlorpyrifos (ISO) cilostazol (EXP) cisplatin (EXP,ISO) cocaine (EXP) Cuprizon (EXP) cyclophosphamide (EXP,ISO) cyhalothrin (EXP) cypermethrin (EXP,ISO) dexamethasone (EXP) dibutyl phthalate (EXP) diclofenac (ISO) diethylstilbestrol (EXP) dimethomorph (EXP) Ethylenethiourea (ISO) fenvalerate (EXP) genistein (EXP) gentamycin (EXP) ibuprofen (ISO) iron dichloride (ISO) ketoconazole (ISO) lamotrigine (ISO) melatonin (EXP) methimazole (EXP) methoxychlor (EXP) methylparaben (EXP) mono(2-ethylhexyl) phthalate (EXP,ISO) mono(5-carboxy-2-ethylpentyl) phthalate (ISO) monoethyl phthalate (ISO) N-methyl-4-phenylpyridinium (ISO) paclitaxel (EXP) paracetamol (EXP,ISO) paraquat (EXP) parthenolide (EXP) PCB138 (ISO) perfluorononanoic acid (EXP) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) procymidone (EXP) propylparaben (EXP) prothioconazole (ISO) pyrethrins (EXP) pyrimidifen (ISO) resmethrin (ISO) resveratrol (EXP) rotenone (ISO) sodium arsenite (ISO) sulforaphane (ISO) testosterone (ISO) Theaflavin 3,3'-digallate (ISO) thiram (ISO) thyroxine (EXP) titanium dioxide (ISO) triphenylstannane (EXP) Triptolide (ISO) triptonide (ISO) trovafloxacin (ISO) Ulipristal (EXP) valproic acid (ISO) vinclozolin (EXP) vincristine (ISO) ziram (EXP)
Biological Process
anti-Mullerian hormone receptor signaling pathway (IEA,ISO,ISS) cell differentiation (IEA) gonad development (IEA) gonadal mesoderm development (IEA) Leydig cell differentiation (ISO,ISS) Mullerian duct regression (IBA,IEA,ISO,ISS,TAS) negative regulation of ovarian follicle development (IDA,ISO) ovarian follicle development (ISO) positive regulation of gene expression (IEA,ISO) positive regulation of NF-kappaB transcription factor activity (IMP) positive regulation of SMAD protein signal transduction (IEA,ISO) preantral ovarian follicle growth (IDA) response to xenobiotic stimulus (IEP) sex determination (ISO) urogenital system development (IDA)
1.
Parabens inhibit the early phase of folliculogenesis and steroidogenesis in the ovaries of neonatal rats.
Ahn HJ, etal., Mol Reprod Dev. 2012 Sep;79(9):626-36. doi: 10.1002/mrd.22070. Epub 2012 Jul 26.
2.
Acute effects of metformin therapy include improvement of insulin resistance and ovarian morphology.
Bayrak A, etal., Fertil Steril. 2007 Jan 12;.
3.
Regulation of gonadotropin gene expression by Mullerian inhibiting substance.
Bedecarrats GY, etal., Proc Natl Acad Sci U S A 2003 Aug 5;100(16):9348-53. Epub 2003 Jul 23.
4.
Anti-Mullerian hormone inhibits initiation of growth of human primordial ovarian follicles in vitro.
Carlsson IB, etal., Hum Reprod. 2006 Sep;21(9):2223-7. Epub 2006 May 23.
5.
Variants of the anti-Mullerian hormone gene in a compound heterozygote with the persistent Mullerian duct syndrome and his family.
Carre-Eusebe D, etal., Hum Genet. 1992 Dec;90(4):389-94.
6.
Serum Mullerian Inhibiting Substance/anti-Mullerian hormone levels in patients with adult granulosa cell tumors directly correlate with aggregate tumor mass as determined by pathology or radiology.
Chang HL, etal., Gynecol Oncol. 2009 Jul;114(1):57-60. Epub 2009 Apr 8.
7.
Prospective case-control study of serum mullerian inhibiting substance and breast cancer risk.
Dorgan JF, etal., J Natl Cancer Inst. 2009 Nov 4;101(21):1501-9. Epub 2009 Oct 9.
8.
Association of anti-mullerian hormone levels with obesity in late reproductive-age women.
Freeman EW, etal., Fertil Steril. 2007 Jan;87(1):101-6. Epub 2006 Nov 15.
9.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
10.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
11.
Isolation of the rat gene for Mullerian inhibiting substance.
Haqq C, etal., Genomics 1992 Apr;12(4):665-9.
12.
Increased expression of Mullerian-inhibiting substance correlates with inhibition of follicular growth in the developing ovary of rats treated with E2 benzoate.
Ikeda Y, etal., Endocrinology 2002 Jan;143(1):304-12.
13.
Parabens Accelerate Ovarian Dysfunction in a 4-Vinylcyclohexene Diepoxide-Induced Ovarian Failure Model.
Lee JH, etal., Int J Environ Res Public Health. 2017 Feb 8;14(2). pii: ijerph14020161. doi: 10.3390/ijerph14020161.
14.
Mullerian inhibitory substance induces growth of rat preantral ovarian follicles.
McGee EA, etal., Biol Reprod. 2001 Jan;64(1):293-8.
15.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
16.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
17.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
18.
Recombinant human Mullerian inhibiting substance inhibits long-term growth of MIS type II receptor-directed transgenic mouse ovarian cancers in vivo.
Pieretti-Vanmarcke R, etal., Clin Cancer Res. 2006 Mar 1;12(5):1593-8.
19.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
20.
GOA pipeline
RGD automated data pipeline
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Mullerian inhibiting substance regulates NFkappaB signaling and growth of mammary epithelial cells in vivo.
Segev DL, etal., J Biol Chem 2001 Jul 20;276(29):26799-806.
23.
The expression of Mullerian inhibiting substance/anti-Mullerian hormone type II receptor protein and mRNA in benign, borderline and malignant ovarian neoplasia.
Song JY, etal., Int J Oncol. 2009 Jun;34(6):1583-91.
24.
Extracellular domain of YWK-II, a human sperm transmembrane protein, interacts with rat Mullerian-inhibiting substance.
Tian XY, etal., Reproduction. 2001 Jun;121(6):873-80.
25.
Early postnatal methoxychlor exposure inhibits folliculogenesis and stimulates anti-Mullerian hormone production in the rat ovary.
Uzumcu M, etal., J Endocrinol. 2006 Dec;191(3):549-58.
26.
The serine/threonine transmembrane receptor ALK2 mediates Mullerian inhibiting substance signaling.
Visser JA, etal., Mol Endocrinol. 2001 Jun;15(6):936-45.
27.
Mullerian inhibiting substance as a novel biomarker of cisplatin-induced ovarian damage.
Yeh J, etal., Biochem Biophys Res Commun. 2006 Sep 22;348(2):337-44. Epub 2006 Jul 13.
28.
Serum and ovarian Mullerian inhibiting substance, and their decline in reproductive aging.
Yeh J, etal., Fertil Steril. 2007 May;87(5):1227-30. Epub 2007 Jan 12.
Amh Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 9,557,451 - 9,559,867 (-) NCBI GRCr8 mRatBN7.2 7 8,906,776 - 8,909,192 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 8,906,836 - 8,909,282 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 11,785,516 - 11,787,864 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 13,661,021 - 13,663,369 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 11,527,544 - 11,529,892 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 11,775,155 - 11,777,503 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 11,775,155 - 11,777,503 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 11,942,870 - 11,945,218 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 10,417,325 - 10,419,673 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 10,417,324 - 10,419,673 (-) NCBI Celera 7 7,089,574 - 7,091,922 (-) NCBI Celera Cytogenetic Map 7 q11 NCBI
AMH Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 2,249,323 - 2,252,073 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 2,249,309 - 2,252,073 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 2,249,322 - 2,252,072 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 2,200,113 - 2,203,072 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 2,200,121 - 2,203,071 NCBI Celera 19 2,183,289 - 2,186,248 (+) NCBI Celera Cytogenetic Map 19 p13.3 NCBI HuRef 19 2,020,229 - 2,023,188 (+) NCBI HuRef CHM1_1 19 2,248,616 - 2,251,575 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 2,222,966 - 2,225,716 (+) NCBI T2T-CHM13v2.0
Amh Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 80,641,074 - 80,643,513 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 80,641,077 - 80,643,482 (+) Ensembl GRCm39 Ensembl GRCm38 10 80,805,240 - 80,807,679 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 80,805,243 - 80,807,648 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 80,267,993 - 80,270,393 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 80,208,377 - 80,210,777 (+) NCBI MGSCv36 mm8 Celera 10 81,823,618 - 81,826,018 (+) NCBI Celera Cytogenetic Map 10 C1 NCBI cM Map 10 39.72 NCBI
Amh Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955495 5,893,446 - 5,895,912 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955495 5,893,375 - 5,896,152 (-) NCBI ChiLan1.0 ChiLan1.0
AMH Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 6,633,643 - 6,636,931 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 5,862,984 - 5,866,275 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 1,260,219 - 1,263,395 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 2,231,984 - 2,236,130 (+) NCBI panpan1.1 PanPan1.1 panPan2
AMH Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 56,785,960 - 56,788,815 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 56,581,099 - 56,583,889 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 57,518,896 - 57,521,686 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 57,518,814 - 57,521,686 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 56,570,917 - 56,573,707 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 57,056,052 - 57,058,835 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 57,256,543 - 57,259,332 (-) NCBI UU_Cfam_GSD_1.0
Amh Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405118 216,489,037 - 216,492,075 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936588 1,343,085 - 1,345,654 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936588 1,342,791 - 1,345,746 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
AMH Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 76,414,427 - 76,418,312 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 76,415,564 - 76,418,315 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 76,982,764 - 76,983,243 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3 Pig Cytomap 2 q14-q21 NCBI
AMH Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 2,047,756 - 2,051,073 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 2,048,319 - 2,050,958 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666081 6,669,905 - 6,672,763 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Amh
.
Predicted Target Of
Count of predictions: 42 Count of miRNA genes: 40 Interacting mature miRNAs: 42 Transcripts: ENSRNOT00000026220 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1300176 Hrtrt10 Heart rate QTL 10 3.19 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 664270 26029351 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 9590142 Scort5 Serum corticosterone level QTL 5 24.4 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 7 1 31962314 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 2298550 Neuinf6 Neuroinflammation QTL 6 3.3 nervous system integrity trait (VT:0010566) spinal cord RT1-B protein level (CMO:0002132) 7 1 27829089 Rat 724560 Plsm3 Polydactyly-luxate syndrome (PLS) morphotypes QTL 3 0.0003 tibia length (VT:0004357) tibia length (CMO:0000450) 7 1 34000259 Rat 7411566 Bw136 Body weight QTL 136 10.4 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 1 31962314 Rat
PMC203309P1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 8,907,628 - 8,907,816 (+) MAPPER mRatBN7.2 Rnor_6.0 7 11,775,948 - 11,776,135 NCBI Rnor6.0 Rnor_5.0 7 11,943,663 - 11,943,850 UniSTS Rnor5.0 RGSC_v3.4 7 10,418,118 - 10,418,305 UniSTS RGSC3.4 Celera 7 7,090,367 - 7,090,554 UniSTS Cytogenetic Map 7 q11 UniSTS
UniSTS:547550
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 8,908,033 - 8,908,431 (+) MAPPER mRatBN7.2 Rnor_6.0 7 11,776,353 - 11,776,750 NCBI Rnor6.0 Rnor_5.0 7 11,944,068 - 11,944,465 UniSTS Rnor5.0 Celera 7 7,090,772 - 7,091,169 UniSTS Cytogenetic Map 7 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
47
112
80
77
48
25
48
6
199
95
92
39
60
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000026220 ⟹ ENSRNOP00000026220
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 8,906,836 - 8,909,282 (-) Ensembl Rnor_6.0 Ensembl 7 11,775,155 - 11,777,503 (-) Ensembl
RefSeq Acc Id:
NM_012902 ⟹ NP_037034
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 9,557,451 - 9,559,867 (-) NCBI mRatBN7.2 7 8,906,776 - 8,909,192 (-) NCBI Rnor_6.0 7 11,775,155 - 11,777,503 (-) NCBI Rnor_5.0 7 11,942,870 - 11,945,218 (-) NCBI RGSC_v3.4 7 10,417,325 - 10,419,673 (-) RGD Celera 7 7,089,574 - 7,091,922 (-) RGD
Sequence:
ATGCAGGGGCCACACCTCTCTCTGCTGCTGCTGCTGCTAGCGACTATGGGGGCTGTGTTACAGGCTGACACAGTTGAAGAACTGACCAATACCAGGGGCCTCATCTTCCTTGAAGATGGGGTCTGGCC
hide sequence
RefSeq Acc Id:
NP_037034 ⟸ NM_012902
- Peptide Label:
precursor
- UniProtKB:
P49000 (UniProtKB/Swiss-Prot), A6K8G0 (UniProtKB/TrEMBL)
- Sequence:
MQGPHLSLLLLLLATMGAVLQADTVEELTNTRGLIFLEDGVWPPSSPPEPLCLVAVRGEGDTSKASLTVVGGLHSYEHAFLEAVQESRWGPQDLATFGVCSTDSQTTLPALQRLGAWLGETGEQQLLV
hide sequence
Ensembl Acc Id:
ENSRNOP00000026220 ⟸ ENSRNOT00000026220
RGD ID: 13695003 Promoter ID: EPDNEW_R5528 Type: single initiation site Name: Amh_1 Description: anti-Mullerian hormone SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 11,777,488 - 11,777,548 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2004-02-26
Amh
anti-Mullerian hormone
anti-mullerian hormone
Symbol and Name status set to approved
625702 APPROVED
2002-06-10
Amh
anti-mullerian hormone
Name updated
70585 PROVISIONAL
Note Type
Note
Reference
gene_disease
inhibits human breast cancer cell growth in vitro through interference with cell cycle progression and induction of apoptosis
70295
gene_disease
inhibits human breast cancer cell growth in vitro through interference with cell cycle progression and induction of apoptosis
70576
gene_expression
produced by Sertoli cells of the testis (males); in females, synthesized by granulosa cells of the ovary and persists until menopause
70295
gene_expression
produced by Sertoli cells of the testis (males); in females, synthesized by granulosa cells of the ovary and persists until menopause
70576
gene_expression
expressed in the granulosa small growing follicles in the ovary
70295
gene_expression
expressed in the granulosa small growing follicles in the ovary
70576
gene_expression
expression is high in the 1-day-postnatal testis and decreases to a low level in the adult testis
1298546
gene_function
testicular glycoprotein ligand for MIS receptor II that causes regression of Mullerian duct, the fallopian tubes and part of the vagina
1298546
gene_process
responsible for the regression of Mullerian duct in male embryos
70295
gene_process
responsible for the regression of Mullerian duct in male embryos
70576
gene_process
plays a key role in male sexual development and differentiation
1298546
gene_process
regulates such hypothalamic/pituitary/gonadal axis processes as steroidogenesis, breast and prostate growth, and ovarian follicle recruitment
1298576
gene_process
enhances the effect of gonadotropin-releasing hormone (GnRH) agonist on the FSHbeta gene promoter and synergizes with the GnRH agonist to stimulate LHbeta gene promoter activity
1298576
gene_process
regulates follicular growth
70576
gene_process
contributes to ovarian development
70576
gene_process
impedes cell cycle progression and apoptosis induction and thus breast cancer cell growth
70295
gene_process
induces NFkappaB to bind to its cognate DNA sequence
70295
gene_process
enhances IEX-1S mRNA expression in breast tissue
70295
gene_process
increases apoptosis in the mouse mammary ductal epithelium
70295
gene_process
potential endogenous hormonal regulator of NFkappaB signaling and growth in breast tissue
70295
gene_product
member of the transforming growth factor b family
gene_regulation
mRNA and protein expression in ovary increased by E2 benzoate; reduction is correlated with the inhibotory effect of EB on the follicular stratification
70295
gene_regulation
mRNA and protein expression in ovary increased by E2 benzoate; reduction is correlated with the inhibotory effect of EB on the follicular stratification
70576
gene_regulation
transcription is estrogen responsive
70576
gene_regulation
activated by steroidogenic factor 1
70576
