Advanced Search (OLGA)

Gene: Cxcr6 (C-X-C motif chemokine receptor 6) Rattus norvegicus

Analyze

Symbol:

Cxcr6

Name:

C-X-C motif chemokine receptor 6

RGD ID:

1642118

Description:

Predicted to enable chemokine binding activity and chemokine receptor activity. Predicted to be involved in several processes, including calcium-mediated signaling; cell chemotaxis; and positive regulation of cytosolic calcium ion concentration. Predicted to be located in plasma membrane. Predicted to be active in external side of plasma membrane. Orthologous to human CXCR6 (C-X-C motif chemokine receptor 6); PARTICIPATES IN chemokine mediated signaling pathway; cytokine mediated signaling pathway; INTERACTS WITH 17beta-estradiol; 17beta-estradiol 3-benzoate; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C-X-C chemokine receptor type 6; chemokine (C-X-C motif) receptor 6; chemokine receptor CXCR6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CXCR6 (C-X-C motif chemokine receptor 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Cxcr6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cxcr6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CXCR6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CXCR6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cxcr6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CXCR6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CXCR6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cxcr6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cxcr6 (C-X-C motif chemokine receptor 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ADAM12 (ADAM metallopeptidase domain 12)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	CXCR6 (C-X-C motif chemokine receptor 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CXCR6 (C-X-C motif chemokine receptor 6)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cxcr6 (C-X-C motif chemokine receptor 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cxcr6 (C-X-C motif chemokine receptor 6)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid)
Xenopus tropicalis (tropical clawed frog):	cxcr6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	132,311,834 - 132,317,001 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	132,306,600 - 132,322,498 (+)	Ensembl				GRCr8
mRatBN7.2	8	123,434,417 - 123,439,568 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	123,416,325 - 123,439,526 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	129,029,512 - 129,031,301 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	127,228,489 - 127,230,278 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	125,057,730 - 125,059,519 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	132,869,712 - 132,870,766 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	132,869,712 - 132,870,767 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	132,020,812 - 132,021,866 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	128,569,564 - 128,570,619 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	122,545,994 - 122,547,048 (+)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

systemic scleroderma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-chloro-2,4-dinitrobenzene (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

7,12-dimethyltetraphene (ISO)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP)

bromobenzene (EXP)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chrysene (ISO)

crocidolite asbestos (ISO)

cyclophosphamide (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

diethylstilbestrol (ISO)

doxorubicin (ISO)

epoxiconazole (ISO)

furan (EXP)

genistein (ISO)

methotrexate (ISO)

nickel atom (ISO)

ozone (ISO)

paclitaxel (ISO)

paracetamol (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

testosterone (EXP,ISO)

tetraphene (ISO)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chemokine-mediated signaling pathway (IEA)

chemotaxis (IEA)

G protein-coupled receptor signaling pathway (IEA)

inflammatory response (IEA)

Cellular Component

membrane (IEA)

Molecular Function

C-X-C chemokine binding (ISO)

C-X-C chemokine receptor activity (IEA,ISO)

chemokine receptor activity (IEA)

coreceptor activity (IEA)

G protein-coupled receptor activity (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

chemokine mediated signaling pathway (IEA)

cytokine mediated signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Dysregulated expression of MIG/CXCL9, IP-10/CXCL10 and CXCL16 and their receptors in systemic sclerosis.	Rabquer BJ, etal., Arthritis Res Ther. 2011 Feb 8;13(1):R18.
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:11017100	PMID:17437534

Genomics

Comparative Map Data

Cxcr6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	132,311,834 - 132,317,001 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	132,306,600 - 132,322,498 (+)	Ensembl				GRCr8
mRatBN7.2	8	123,434,417 - 123,439,568 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	123,416,325 - 123,439,526 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	129,029,512 - 129,031,301 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	127,228,489 - 127,230,278 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	125,057,730 - 125,059,519 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	132,869,712 - 132,870,766 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	132,869,712 - 132,870,767 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	132,020,812 - 132,021,866 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	128,569,564 - 128,570,619 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	122,545,994 - 122,547,048 (+)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

CXCR6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	45,940,915 - 45,948,351 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	45,940,933 - 45,948,353 (+)	Ensembl			hg38	GRCh38
GRCh37	3	45,982,407 - 45,989,843 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	45,959,977 - 45,964,849 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	3	45,959,976 - 45,964,849	NCBI
Celera	3	45,922,592 - 45,927,464 (+)	NCBI		Celera
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	46,029,014 - 46,033,886 (+)	NCBI		HuRef
CHM1_1	3	45,934,937 - 45,939,809 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	45,956,798 - 45,964,234 (+)	NCBI		T2T-CHM13v2.0

Cxcr6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	123,635,542 - 123,640,819 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	123,635,540 - 123,640,825 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	123,806,477 - 123,811,754 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	123,806,475 - 123,811,760 (+)	Ensembl			mm10	GRCm38
MGSCv37	9	123,715,595 - 123,720,872 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	123,655,183 - 123,660,452 (+)	NCBI		MGSCv36	mm8
Celera	9	124,254,890 - 124,260,158 (+)	NCBI		Celera
Cytogenetic Map	9	F4	NCBI
cM Map	9	74.57	NCBI

Cxcr6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	26,058,170 - 26,059,216 (-)	Ensembl
ChiLan1.0	NW_004955420	26,056,464 - 26,061,992 (-)	NCBI	ChiLan1.0	ChiLan1.0

CXCR6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	45,908,856 - 45,913,375 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	45,910,606 - 45,918,049 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	45,848,722 - 45,856,145 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	46,955,051 - 46,962,490 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	46,960,610 - 46,961,638 (+)	Ensembl			panPan2	panpan1.1

CXCR6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	42,565,251 - 42,569,647 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	42,565,251 - 42,566,276 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	42,480,213 - 42,484,961 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	43,047,331 - 43,052,077 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	43,047,336 - 43,052,021 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	42,288,235 - 42,292,978 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	42,695,451 - 42,700,197 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	42,970,759 - 42,975,506 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cxcr6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	200,483,742 - 200,489,756 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936596	37,067 - 38,092 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936596	31,641 - 44,561 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CXCR6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	29,095,900 - 29,100,667 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	29,095,900 - 29,100,666 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	32,192,310 - 32,197,076 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CXCR6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	7,413,871 - 7,419,229 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	7,414,334 - 7,419,213 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	159,746,814 - 159,751,690 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cxcr6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624730	74,960,324 - 74,961,337 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cxcr6
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	114,913,901 - 114,919,118 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	69
Count of miRNA genes:	60
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000008294
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat

Markers in Region

BQ205885

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	123,439,115 - 123,439,281 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	132,871,049 - 132,871,214	NCBI	Rnor6.0
Rnor_5.0	8	132,022,149 - 132,022,314	UniSTS	Rnor5.0
RGSC_v3.4	8	128,570,901 - 128,571,066	UniSTS	RGSC3.4
Celera	8	122,547,331 - 122,547,496	UniSTS
RH 3.4 Map	8	1333.2	UniSTS
Cytogenetic Map	8	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	43	82	70	69	38	91	38	6	298	165	10	62	71	77	31	10	10

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001102587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039080642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	DQ132631	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862603	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862604	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862605	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862608	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862611	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862612	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862614	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862616	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862617	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862620	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MN862622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000008294 ⟹ ENSRNOP00000008294

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	123,434,414 - 123,439,526 (+)	Ensembl
Rnor_6.0 Ensembl	8	132,869,712 - 132,870,767 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111911 ⟹ ENSRNOP00000079305

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	123,416,325 - 123,439,383 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000124892 ⟹ ENSRNOP00000100445

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	132,306,600 - 132,322,498 (+)	Ensembl

RefSeq Acc Id:

NM_001102587 ⟹ NP_001096057

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	132,315,206 - 132,316,995 (+)	NCBI
mRatBN7.2	8	123,437,779 - 123,439,568 (+)	NCBI
Rnor_6.0	8	132,869,712 - 132,870,766 (+)	NCBI
Rnor_5.0	8	132,020,812 - 132,021,866 (+)	NCBI
RGSC_v3.4	8	128,569,564 - 128,570,619 (+)	RGD
Celera	8	122,545,994 - 122,547,048 (+)	NCBI

Sequence:

show sequence

ATGGATGATGGGCATCAAGAGAAAGATCTGGACGATGACGTCTACGGGGGAGATCCCTGGCTCT
TCAACAACTCCAGTGGTAACAGCCAGGAACACAAACGCTTCCTAAAGTTCAAGGAGGTTTTTCT
GCCCTGCATGTATCTGGTAGTGTTTGTCCTTGGACTGCTAGGGAACTCCCTGGTTCTGATTATA
TACATTTTCTACCAGAGGCTGAGGAGTCTGACAGACGTGTTCCTGCTGAACTTGCCCCTGGCTG
ACCTGGTGTTTGTCTGTACTCTGCCCTTTTGGGCCTACGCAGGCACCTATGAGTGGGTCTTTGG
CACAGCCATGTGCAAAACTCTTCGAAGCATGTATGCAATGAACTTCTACGTGTCCATGCTCACT
CTCACCTGCATCACGGTGGATCGTTTCGTTGTAGTGGTCCAGGCTACCAAGGCCTTCAACAGGC
AGGCTAAGTGGAAGATCTGGGGCCAAGTCACTTGCTTGCTCATCTGGGTAGTCTCCCTGCTGGT
TTCTTTGCCACAGATCATCTACAGCAGAGTTGGACATATTGACAGGCTTATCTGTCAGTTCCAC
AACGAGGCGATATCGACTGTGGTTCTTGTTCTACAGATGACTCTGGGGTTCTTCCTGCCATTGC
TCACTATGATTCTGTGCTACTCAGGCATTATCAAGACCTTGCTTCACGCTCGAAACTTCCAGAA
GCACAAATCTCTAAAGATCATCTTCCTTGTAGTGGCTACGTTCCTGCTGACCCAGACACCCTTC
AACATTGCCATGTTAATCCAGTGGATAAGTTGGGAATACAGTACCATAACCAGCTTTCAGTATG
TCGTCTTAGTGACAGAGGCGATAGCATACCTTCGGGCCTGCCTTAACCCTGTACTCTATGCCTT
TGTTGGCTTAAAGTTCCGGAAGAACCTCTGGAAACTTATGAAGGACATCAGCTGCCTCTCTCGT
CTGGGAGTCTCAAGTCAGTGGAAGTCTTCTGAGGACAATTCCAAGACTTGTTCTGCCTCCCACA
ATGCAGAGACCACCAGTATGTTCCAATTGTAG

hide sequence

RefSeq Acc Id:

XM_039080642 ⟹ XP_038936570

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	132,311,834 - 132,317,001 (+)	NCBI
mRatBN7.2	8	123,434,417 - 123,439,568 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001096057	(Get FASTA)	NCBI Sequence Viewer
	XP_038936570	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAZ66333	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000100445
	ENSRNOP00000100445.1
GenBank Protein	QJQ49331	(Get FASTA)	NCBI Sequence Viewer
	QJQ49332	(Get FASTA)	NCBI Sequence Viewer
	QJQ49333	(Get FASTA)	NCBI Sequence Viewer
	QJQ49334	(Get FASTA)	NCBI Sequence Viewer
	QJQ49335	(Get FASTA)	NCBI Sequence Viewer
	QJQ49336	(Get FASTA)	NCBI Sequence Viewer
	QJQ49337	(Get FASTA)	NCBI Sequence Viewer
	QJQ49338	(Get FASTA)	NCBI Sequence Viewer
	QJQ49339	(Get FASTA)	NCBI Sequence Viewer
	QJQ49340	(Get FASTA)	NCBI Sequence Viewer
	QJQ49341	(Get FASTA)	NCBI Sequence Viewer
	QJQ49342	(Get FASTA)	NCBI Sequence Viewer
	QJQ49343	(Get FASTA)	NCBI Sequence Viewer
	QJQ49344	(Get FASTA)	NCBI Sequence Viewer
	QJQ49345	(Get FASTA)	NCBI Sequence Viewer
	QJQ49346	(Get FASTA)	NCBI Sequence Viewer
	QJQ49347	(Get FASTA)	NCBI Sequence Viewer
	QJQ49348	(Get FASTA)	NCBI Sequence Viewer
	QJQ49349	(Get FASTA)	NCBI Sequence Viewer
	QJQ49350	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001096057 ⟸ NM_001102587

- UniProtKB:

A7ISD5 (UniProtKB/TrEMBL), A0A6M4C4C7 (UniProtKB/TrEMBL), A0A6M4C4D9 (UniProtKB/TrEMBL), A0A6M4C4J1 (UniProtKB/TrEMBL), A0A6M4C4K1 (UniProtKB/TrEMBL), A0A6M4C534 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDDGHQEKDLDDDVYGGDPWLFNNSSGNSQEHKRFLKFKEVFLPCMYLVVFVLGLLGNSLVLII
YIFYQRLRSLTDVFLLNLPLADLVFVCTLPFWAYAGTYEWVFGTAMCKTLRSMYAMNFYVSMLT
LTCITVDRFVVVVQATKAFNRQAKWKIWGQVTCLLIWVVSLLVSLPQIIYSRVGHIDRLICQFH
NEAISTVVLVLQMTLGFFLPLLTMILCYSGIIKTLLHARNFQKHKSLKIIFLVVATFLLTQTPF
NIAMLIQWISWEYSTITSFQYVVLVTEAIAYLRACLNPVLYAFVGLKFRKNLWKLMKDISCLSR
LGVSSQWKSSEDNSKTCSASHNAETTSMFQL

hide sequence

Ensembl Acc Id:

ENSRNOP00000008294 ⟸ ENSRNOT00000008294

RefSeq Acc Id:	XP_038936570 ⟸ XM_039080642
- Peptide Label:	isoform X1
- UniProtKB:	F7F415 (UniProtKB/TrEMBL), A6I4C7 (UniProtKB/TrEMBL), A0A6M4C4C7 (UniProtKB/TrEMBL), A0A6M4C4D9 (UniProtKB/TrEMBL), A0A6M4C4J1 (UniProtKB/TrEMBL), A0A6M4C4K1 (UniProtKB/TrEMBL), A0A6M4C534 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000079305 ⟸ ENSRNOT00000111911

Ensembl Acc Id:

ENSRNOP00000100445 ⟸ ENSRNOT00000124892

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A7ISD5-F1-model_v2	AlphaFold	A7ISD5	1-351	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1642118	AgrOrtholog
BioCyc Gene	G2FUF-28604	BioCyc
Ensembl Genes	ENSRNOG00000006319	Ensembl
	ENSRNOG00000089617	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000124892	ENTREZGENE
	ENSRNOT00000124892.1	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	Chmkine_rcpt	UniProtKB/TrEMBL
	CXC_6_rcpt	UniProtKB/TrEMBL
	GPCR1	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
KEGG Report	rno:100124593	UniProtKB/TrEMBL
NCBI Gene	100124593	ENTREZGENE
PANTHER	CELL ADHESION MOLECULE	UniProtKB/TrEMBL
	PTHR10489:SF705	UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/TrEMBL
PhenoGen	Cxcr6	PhenoGen
PRINTS	CCCHEMOKINER	UniProtKB/TrEMBL
	CXCCHMKINER6	UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000006319	RatGTEx
	ENSRNOG00000089617	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A0A6M4C4C7	ENTREZGENE, UniProtKB/TrEMBL
	A0A6M4C4D9	ENTREZGENE, UniProtKB/TrEMBL
	A0A6M4C4F5_RAT	UniProtKB/TrEMBL
	A0A6M4C4G2_RAT	UniProtKB/TrEMBL
	A0A6M4C4J1	ENTREZGENE, UniProtKB/TrEMBL
	A0A6M4C4K1	ENTREZGENE, UniProtKB/TrEMBL
	A0A6M4C4N8_RAT	UniProtKB/TrEMBL
	A0A6M4C4Q0_RAT	UniProtKB/TrEMBL
	A0A6M4C4Q9_RAT	UniProtKB/TrEMBL
	A0A6M4C4U0_RAT	UniProtKB/TrEMBL
	A0A6M4C527_RAT	UniProtKB/TrEMBL
	A0A6M4C531_RAT	UniProtKB/TrEMBL
	A0A6M4C534	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LGZ2_RAT	UniProtKB/TrEMBL
	A6I4C7	ENTREZGENE, UniProtKB/TrEMBL
	A7ISD5	ENTREZGENE, UniProtKB/TrEMBL
	F7F415	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-22	Cxcr6	C-X-C motif chemokine receptor 6	Cxcr6	chemokine (C-X-C motif) receptor 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-16	Cxcr6	chemokine (C-X-C motif) receptor 6	Cxcr6	chemokine receptor CXCR6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2007-08-31	Cxcr6	chemokine receptor CXCR6			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)