Advanced Search (OLGA)

Gene: Kin (Kin17 DNA and RNA binding protein) Rattus norvegicus

Analyze

Symbol:

Kin

Name:

Kin17 DNA and RNA binding protein

RGD ID:

1596107

Description:

Predicted to enable RNA binding activity and double-stranded DNA binding activity. Predicted to be involved in DNA damage response and DNA replication. Predicted to be located in nuclear matrix. Predicted to be part of protein-containing complex. Predicted to be active in nucleus. Orthologous to human KIN (Kin17 DNA and RNA binding protein); INTERACTS WITH 6-propyl-2-thiouracil; aconitine; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

antigenic determinant of rec-A protein; antigenic determinant of rec-A protein homolog; antigenic determinant of rec-A protein homolog (mouse); DNA/RNA-binding protein KIN17; LOC689197; similar to antigenic determinant of rec-A protein

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	KIN (Kin17 DNA and RNA binding protein)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Kin (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Kin (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	KIN (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	KIN (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Kin (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	KIN (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	KIN (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Kin (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Kin (Kin17 DNA and RNA binding protein)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	KIN (Kin17 DNA and RNA binding protein)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Kin (Kin17 DNA and RNA binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	kin (Kin17 DNA and RNA binding protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dxbp-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dxbp-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RTS2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	kin17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	kin17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	kin	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	73,323,189 - 73,333,542 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	73,322,801 - 73,333,542 (-)	Ensembl				GRCr8
mRatBN7.2	17	68,413,483 - 68,431,392 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	68,413,486 - 68,423,845 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	71,895,970 - 71,906,291 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	75,724,704 - 75,735,025 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	69,767,757 - 69,778,078 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	72,198,882 - 72,216,780 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	72,198,866 - 72,209,279 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	73,884,586 - 73,902,539 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	79,728,511 - 79,738,856 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	67,899,986 - 67,910,331 (-)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,4'-trichlorobiphenyl (ISO)

2-hydroxypropanoic acid (ISO)

2-palmitoylglycerol (ISO)

6-propyl-2-thiouracil (EXP)

aconitine (EXP)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (EXP)

caffeine (ISO)

clofibrate (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

gold atom (ISO)

gold(0) (ISO)

hydrogen peroxide (ISO)

inulin (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methimazole (EXP)

paracetamol (ISO)

PCB138 (ISO)

perfluorooctane-1-sulfonic acid (ISO)

rac-lactic acid (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

theophylline (ISO)

thiram (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

DNA damage response (IBA,IEA,ISO)

DNA recombination (IEA)

DNA repair (IEA)

DNA replication (IEA,ISO)

mRNA processing (IEA)

Cellular Component

cytoplasm (IEA)

cytosol (ISO)

nuclear matrix (ISO)

nucleoplasm (ISO)

nucleus (IBA,IEA,ISO)

protein-containing complex (ISO)

Molecular Function

DNA binding (IEA)

double-stranded DNA binding (IBA,ISO)

metal ion binding (IEA)

protein binding (ISO)

RNA binding (IEA,ISO)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1923796	PMID:8954809	PMID:12359749	PMID:12754299	PMID:12853634	PMID:16182450	PMID:17045609	PMID:23349634

Genomics

Comparative Map Data

Kin
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	73,323,189 - 73,333,542 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	73,322,801 - 73,333,542 (-)	Ensembl				GRCr8
mRatBN7.2	17	68,413,483 - 68,431,392 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	68,413,486 - 68,423,845 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	71,895,970 - 71,906,291 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	75,724,704 - 75,735,025 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	69,767,757 - 69,778,078 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	72,198,882 - 72,216,780 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	72,198,866 - 72,209,279 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	73,884,586 - 73,902,539 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	79,728,511 - 79,738,856 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	67,899,986 - 67,910,331 (-)	NCBI		Celera
Cytogenetic Map	17	q12.3	NCBI

KIN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	7,750,962 - 7,787,993 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	7,750,962 - 7,787,994 (-)	Ensembl			hg38	GRCh38
GRCh37	10	7,792,925 - 7,829,956 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	7,837,373 - 7,869,950 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	7,837,372 - 7,869,950	NCBI
Celera	10	7,723,177 - 7,755,764 (-)	NCBI		Celera
Cytogenetic Map	10	p14	NCBI
HuRef	10	7,711,272 - 7,748,358 (-)	NCBI		HuRef
CHM1_1	10	7,792,885 - 7,829,730 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	7,751,725 - 7,788,763 (-)	NCBI		T2T-CHM13v2.0

Kin
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	10,085,397 - 10,097,512 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	10,085,404 - 10,097,617 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	10,080,551 - 10,092,701 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	10,080,593 - 10,092,806 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	10,002,239 - 10,014,328 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	9,998,465 - 10,010,554 (+)	NCBI		MGSCv36	mm8
Celera	2	10,019,685 - 10,031,776 (+)	NCBI		Celera
Cytogenetic Map	2	A1	NCBI
cM Map	2	6.88	NCBI

Kin
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955421	24,196,909 - 24,234,320 (-)	Ensembl
ChiLan1.0	NW_004955421	24,196,909 - 24,234,320 (-)	NCBI	ChiLan1.0	ChiLan1.0

KIN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	20,299,905 - 20,339,559 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	20,307,073 - 20,344,886 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	7,783,842 - 7,820,778 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	7,764,233 - 7,801,350 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	7,768,263 - 7,801,350 (-)	Ensembl			panPan2	panpan1.1

KIN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	28,325,243 - 28,360,790 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	28,324,723 - 28,360,773 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	25,366,091 - 25,401,647 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	28,706,828 - 28,742,388 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	28,706,316 - 28,742,371 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	25,813,254 - 25,848,818 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	26,655,185 - 26,690,736 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	27,373,305 - 27,408,834 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Kin
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	30,865,976 - 30,893,520 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936484	7,030,862 - 7,060,125 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936484	7,031,160 - 7,058,696 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

KIN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	63,599,632 - 63,631,001 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	10	63,599,612 - 63,634,844 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

KIN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	7,801,716 - 7,836,958 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	9	7,799,492 - 7,836,719 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666051	13,197,734 - 13,232,609 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Kin
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624775	2,716,150 - 2,745,442 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624775	2,715,748 - 2,745,524 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Kin
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	16,174,794 - 16,185,160 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Kin
95 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	17
Count of miRNA genes:	14
Interacting mature miRNAs:	17
Transcripts:	ENSRNOT00000039689
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	30066472	75066472	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
631502	Cm26	Cardiac mass QTL 26	3.71		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	70613502	86062352	Rat
1354588	Bvd4	Brain ventricular dilatation QTL 4	5.31	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	58194064	87388164	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	33104645	78104645	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	38031354	83031354	Rat
2317038	Ginf3	Gastrointestinal inflammation QTL 3	2.89	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	17	54829503	93515804	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	38031354	83031354	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	35446949	75762341	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	38031354	83031354	Rat
61466	Niddm12	Non-insulin dependent diabetes mellitus QTL 12	3.2	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	65154872	93515804	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	38031354	83031354	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	33104645	78104645	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
4889894	Eae33	Experimental allergic encephalomyelitis QTL 33	5.2	0.0001	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	55604597	93006569	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	37687877	82687877	Rat
1300131	Bp193	Blood pressure QTL 193	3.3		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	68550040	93515804	Rat
7488963	Bp369	Blood pressure QTL 369		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	63697147	82818564	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	41062352	86062352	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	36045537	81045537	Rat
2302365	Gluco40	Glucose level QTL 40	4.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	64569820	86954580	Rat

Markers in Region

BE114414

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	68,413,518 - 68,413,709 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	72,198,918 - 72,199,108	NCBI	Rnor6.0
Rnor_5.0	17	73,884,622 - 73,884,812	UniSTS	Rnor5.0
RGSC_v3.4	17	79,728,539 - 79,728,729	UniSTS	RGSC3.4
Celera	17	67,900,014 - 67,900,204	UniSTS
RH 3.4 Map	17	658.8	UniSTS
Cytogenetic Map	17	q12.3	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	91	59	6	355	191	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109529	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276748	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473990	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000039689 ⟹ ENSRNOP00000028940

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	73,323,197 - 73,333,542 (-)	Ensembl
mRatBN7.2 Ensembl	17	68,413,486 - 68,423,845 (-)	Ensembl
Rnor_6.0 Ensembl	17	72,198,866 - 72,209,279 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000167608 ⟹ ENSRNOP00000102662

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	73,322,801 - 73,333,542 (-)	Ensembl

RefSeq Acc Id:

NM_001109529 ⟹ NP_001102999

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	73,323,197 - 73,333,542 (-)	NCBI
mRatBN7.2	17	68,413,491 - 68,423,838 (-)	NCBI
Rnor_6.0	17	72,198,890 - 72,209,232 (-)	NCBI
Rnor_5.0	17	73,884,586 - 73,902,539 (-)	NCBI
RGSC_v3.4	17	79,728,511 - 79,738,856 (-)	RGD
Celera	17	67,899,986 - 67,910,331 (-)	RGD

Sequence:

show sequence

TCCAGTTCCGCTTCCGACGGCTTCGCTGTTGTACTCTCAGGGTCGCCATGGGCAAGTCAGATTT
TCTGAGCCCCAAGGCCATCGCGAATAGAATTAAGTCTAAAGGGCTGCAGAAGCTTCGCTGGTAC
TGCCAGATGTGCCAAAAACAATGCCGCGACGAGAATGGTTTCAAGTGTCACTGTATGTCCGAGT
CTCATCAAAGACAGCTGTTGCTGGCTTCAGAAAATCCTCAGCAGTTTATGGATTATTTTTCAGA
GGAATTCCGAAATGACTTTCTGGAACTTCTGAGAAGACGCTTTGGCACTAAGAGAGTCCACAAC
AACATTGTCTACAATGAATACATCAGCCACCGAGAGCACATCCACATGAACGCCACTCAGTGGG
AGACGCTGACTGACTTTACCAAGTGGCTGGGCAGAGAGGGCTTGTGTAAAGTGGATGAGACACC
AAAAGGCTGGTACATTCAGTACATAGACAGAGACCCAGAAACTATACGTCGGCAACTGGAATTA
GAAAAAAAGAAGAAGCAAGATCTTGACGATGAAGAAAAAACTGCCAAATTCATTGAGGAGCAGG
TGAGAAGAGGCCTAGAAGGGAAAGAGCAGGAGACGCCTGTCTTTACAGAGTTAAGTCGAGAAAA
TGATGAAGAAAAGGTCACGTTCAATCTGAATAAAGGAGCGGGTAGCTCAGCGGGAGCAACAACG
TCCAAGTCAAGCTCGCTGGGACCGAGCGCACTGAAGATGCTGGGGAGCACAGCATCCGTGAGGC
GGAAAGAGTCTTCACAGAGCTCAGCTCAGCCTGCGAAGAAGAAGAAGAAGTCTGCCCTGGATGA
GATCATGGAGATTGAGGAGGAAAAGAAAAGGACCGCACGGACAGACTCCTGGTTACAGCCTGGG
ATCATTGTGAAAATTATAACGAAGAAGCTTGGGGAGAAATACCACAAGAAGAAAGGGGTCGTTA
AGGAAGTGATTGACAGATACACAGCTGTGGTAAAGATGACTGACTCCGGAGACAGGCTGAAACT
GGACCAGACTCATTTAGAGACAGTCATTCCAGCCCCAGGGAAAAGAGTTCTAGTTTTAAACGGA
GGCTACAGAGGAAATGAAGGCACCCTCGAGTCCATCAATGAAAAGACTTTTTCAGCCACGATAG
TCATTGAAACGGGACCTTTGAAAGGGCGCAGACTTGAAGGTATTCAGTATGAAGACATATCTAA
ACTTGCTTGAGTTTGACAATTTGTTAATAACACATTGAAATTGTAAAGCATCAAATTGATGTTA
GCCACGGCACTGTGTAACTCTACTGTGTTAGGGGATTTGTTTATAAAGAAAGTCATCTATTTAA
ATACCACTGGATAGCTGTTTGGGTAAATTTATAATAAAATCTAATTTTTTTT

hide sequence

RefSeq Acc Id:

XM_063276748 ⟹ XP_063132818

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	73,323,189 - 73,330,689 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102999	(Get FASTA)	NCBI Sequence Viewer
	XP_063132818	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL78624	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000028940
	ENSRNOP00000028940.4
	ENSRNOP00000102662.1

RefSeq Acc Id:

NP_001102999 ⟸ NM_001109529

- UniProtKB:

D3ZRI6 (UniProtKB/TrEMBL), A6JLU7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGKSDFLSPKAIANRIKSKGLQKLRWYCQMCQKQCRDENGFKCHCMSESHQRQLLLASENPQQF
MDYFSEEFRNDFLELLRRRFGTKRVHNNIVYNEYISHREHIHMNATQWETLTDFTKWLGREGLC
KVDETPKGWYIQYIDRDPETIRRQLELEKKKKQDLDDEEKTAKFIEEQVRRGLEGKEQETPVFT
ELSRENDEEKVTFNLNKGAGSSAGATTSKSSSLGPSALKMLGSTASVRRKESSQSSAQPAKKKK
KSALDEIMEIEEEKKRTARTDSWLQPGIIVKIITKKLGEKYHKKKGVVKEVIDRYTAVVKMTDS
GDRLKLDQTHLETVIPAPGKRVLVLNGGYRGNEGTLESINEKTFSATIVIETGPLKGRRLEGIQ
YEDISKLA

hide sequence

Ensembl Acc Id:

ENSRNOP00000028940 ⟸ ENSRNOT00000039689

RefSeq Acc Id:	XP_063132818 ⟸ XM_063276748
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000102662 ⟸ ENSRNOT00000167608

Protein Domains

DNA/RNA-binding protein Kin17 WH-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZRI6-F1-model_v2	AlphaFold	D3ZRI6	1-392	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700560

Promoter ID:

EPDNEW_R11083

Type:

multiple initiation site

Name:

Kin_1

Description:

Kin17 DNA and RNA binding protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	72,209,205 - 72,209,265	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1596107	AgrOrtholog
BioCyc Gene	G2FUF-8756	BioCyc
Ensembl Genes	ENSRNOG00000026690	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000039689	ENTREZGENE
	ENSRNOT00000039689.7	UniProtKB/TrEMBL
	ENSRNOT00000167608.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.2030	UniProtKB/TrEMBL
	2.30.30.140	UniProtKB/TrEMBL
	2.30.30.30	UniProtKB/TrEMBL
InterPro	C2H2-Znf_KIN17	UniProtKB/TrEMBL
	DNA/RNA-bd_Kin17_cons_reg	UniProtKB/TrEMBL
	KIN17-like	UniProtKB/TrEMBL
	KIN17_WH-like_sf	UniProtKB/TrEMBL
	KN17_SH3	UniProtKB/TrEMBL
	KOW_KIN17	UniProtKB/TrEMBL
	Rib_L2_dom2	UniProtKB/TrEMBL
	Znf_C2H2_sf	UniProtKB/TrEMBL
KEGG Report	rno:689197	UniProtKB/TrEMBL
NCBI Gene	689197	ENTREZGENE
PANTHER	DNA/RNA-BINDING PROTEIN KIN17	UniProtKB/TrEMBL
	PTHR12805	UniProtKB/TrEMBL
Pfam	C2H2-zf_KIN17	UniProtKB/TrEMBL
	Kin17_mid	UniProtKB/TrEMBL
	KN17_SH3	UniProtKB/TrEMBL
	SH3_KIN17_C	UniProtKB/TrEMBL
PhenoGen	Kin	PhenoGen
RatGTEx	ENSRNOG00000026690	RatGTEx
SMART	Kin17_mid	UniProtKB/TrEMBL
Superfamily-SCOP	SSF57667	UniProtKB/TrEMBL
UniProt	A0ABK0L225_RAT	UniProtKB/TrEMBL
	A6JLU7	ENTREZGENE, UniProtKB/TrEMBL
	D3ZRI6	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-11-19	Kin	Kin17 DNA and RNA binding protein	Kin	antigenic determinant of rec-A protein homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-12-15	Kin	antigenic determinant of rec-A protein homolog (mouse)	Kin	antigenic determinant of rec-A protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Kin	antigenic determinant of rec-A protein	LOC689197	similar to antigenic determinant of rec-A protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC689197	similar to antigenic determinant of rec-A protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message