Advanced Search (OLGA)

Gene: Psmd14 (proteasome 26S subunit, non-ATPase 14) Rattus norvegicus

Analyze

Symbol:

Psmd14

Name:

proteasome 26S subunit, non-ATPase 14

RGD ID:

1594532

Description:

Predicted to enable endopeptidase activator activity; metal-dependent deubiquitinase activity; and proteasome binding activity. Involved in response to ethanol. Part of cytosolic proteasome complex. Orthologous to human PSMD14 (proteasome 26S subunit, non-ATPase 14); PARTICIPATES IN ataxia telangiectasia-mutated (ATM) signaling pathway; ubiquitin/proteasome degradation pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

26S proteasome non-ATPase regulatory subunit 14; LOC295644; LOC311078; MGC114474; proteasome (prosome, macropain) 26S subunit, non-ATPase, 14; similar to T-Brain-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSMD14 (proteasome 26S subunit, non-ATPase 14)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Psmd14 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Psmd14 (proteasome 26S subunit, non-ATPase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSMD14 (proteasome 26S subunit, non-ATPase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSMD14 (proteasome 26S subunit, non-ATPase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psmd14 (proteasome 26S subunit, non-ATPase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSMD14 (proteasome 26S subunit, non-ATPase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSMD14 (proteasome 26S subunit, non-ATPase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psmd14 (proteasome 26S subunit, non-ATPase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Psmd14 (proteasome 26S subunit, non-ATPase 14)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PSMD14 (proteasome 26S subunit, non-ATPase 14)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Psmd14 (proteasome (prosome, macropain) 26S subunit, non-ATPase, 14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	psmd14 (proteasome 26S subunit, non-ATPase 14)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPN11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpn-11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpn-11	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rpn11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psmd14	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	66,662,933 - 66,755,666 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	66,662,900 - 66,755,665 (+)	Ensembl				GRCr8
mRatBN7.2	3	46,254,338 - 46,347,076 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	46,254,330 - 46,347,076 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	49,600,021 - 49,692,757 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	58,183,542 - 58,276,273 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	55,966,122 - 56,058,875 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	47,578,449 - 47,673,330 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	47,578,384 - 47,673,338 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	54,249,938 - 54,344,886 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	43,660,136 - 43,699,412 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	45,922,238 - 46,014,721 (+)	NCBI		Celera
Cytogenetic Map	3	q21	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alcohol-associated liver disease (IEP)

autistic disorder (ISO)

Disease Progression (ISO)

neuroblastoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

1H-pyrazole (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,6-dimethoxyphenol (ISO)

2-bromohexadecanoic acid (ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP,ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenic trichloride (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

captan (ISO)

carbon nanotube (ISO)

chloropicrin (ISO)

chlorpyrifos (EXP)

cisplatin (ISO)

clofibrate (ISO)

clozapine (ISO)

cobalt dichloride (EXP,ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dibenzo[a,l]pyrene (ISO)

Dibutyl phosphate (ISO)

dicrotophos (ISO)

ethanol (EXP,ISO)

finasteride (EXP)

fluorescein 5-isothiocyanate (ISO)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

fulvestrant (ISO)

furan (EXP)

furfural (ISO)

glafenine (EXP)

gold atom (ISO)

gold(0) (ISO)

inulin (ISO)

ivermectin (ISO)

leflunomide (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

monosodium L-glutamate (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nefazodone (EXP)

nimesulide (EXP)

nitrates (ISO)

ochratoxin A (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

phlorizin (ISO)

pirinixic acid (ISO)

propiconazole (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

resveratrol (ISO)

rotenone (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thiram (ISO)

topotecan (EXP)

trichloroethene (ISO)

trimellitic anhydride (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valdecoxib (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

double-strand break repair via homologous recombination (IEA,ISO)

double-strand break repair via nonhomologous end joining (IEA,ISO)

protein K63-linked deubiquitination (IEA,ISO)

proteolysis (IEA)

regulation of macroautophagy (IEA,ISO)

regulation of proteasomal protein catabolic process (IEA,ISO)

response to ethanol (IEP)

retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum (IEA,ISO)

Cellular Component

cytosolic proteasome complex (IDA)

nucleoplasm (IEA,ISO)

proteasome accessory complex (IEA,ISO)

proteasome complex (IEA,ISO)

proteasome regulatory particle, lid subcomplex (IEA,ISO)

Molecular Function

endopeptidase activator activity (IEA,ISO)

hydrolase activity (IEA)

K63-linked deubiquitinase activity (IEA,ISO)

metal ion binding (IEA)

metal-dependent deubiquitinase activity (IEA,ISO)

metallopeptidase activity (IEA)

peptidase activity (IEA)

proteasome binding (IEA,ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ataxia telangiectasia-mutated (ATM) signaling pathway (ISO)

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Chronic ethanol feeding affects proteasome-interacting proteins.	Bousquet-Dubouch MP, etal., Proteomics. 2009 Jul;9(13):3609-22. doi: 10.1002/pmic.200800959.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Push back to respond better: regulatory inhibition of the DNA double-strand break response.	Panier S and Durocher D, Nat Rev Mol Cell Biol. 2013 Oct;14(10):661-72. doi: 10.1038/nrm3659. Epub 2013 Sep 4.
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:9688553	PMID:12477932	PMID:15632090	PMID:16857966	PMID:16973439	PMID:17323924	PMID:17329080	PMID:17728463	PMID:18162577	PMID:19182904	PMID:21630459	PMID:21949367
PMID:22909820	PMID:23376485	PMID:33609735

Genomics

Comparative Map Data

Psmd14
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	66,662,933 - 66,755,666 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	66,662,900 - 66,755,665 (+)	Ensembl				GRCr8
mRatBN7.2	3	46,254,338 - 46,347,076 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	46,254,330 - 46,347,076 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	49,600,021 - 49,692,757 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	58,183,542 - 58,276,273 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	55,966,122 - 56,058,875 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	47,578,449 - 47,673,330 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	47,578,384 - 47,673,338 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	54,249,938 - 54,344,886 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	43,660,136 - 43,699,412 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	45,922,238 - 46,014,721 (+)	NCBI		Celera
Cytogenetic Map	3	q21	NCBI

PSMD14
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	161,308,425 - 161,411,717 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	161,308,414 - 161,411,720 (+)	Ensembl			hg38	GRCh38
GRCh37	2	162,164,936 - 162,268,228 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	161,873,186 - 161,976,172 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	161,990,446 - 162,093,433	NCBI
Celera	2	155,776,557 - 155,880,315 (+)	NCBI		Celera
Cytogenetic Map	2	q24.2	NCBI
HuRef	2	154,049,213 - 154,152,684 (+)	NCBI		HuRef
CHM1_1	2	162,170,938 - 162,274,393 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	161,766,719 - 161,870,044 (+)	NCBI		T2T-CHM13v2.0

Psmd14
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	61,542,038 - 61,630,720 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	61,542,038 - 61,630,720 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	61,711,694 - 61,800,376 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	61,711,694 - 61,800,376 (+)	Ensembl			mm10	GRCm38
MGSCv37	2	61,549,751 - 61,638,433 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	61,512,608 - 61,601,215 (+)	NCBI		MGSCv36	mm8
Celera	2	63,413,313 - 63,502,325 (+)	NCBI		Celera
Cytogenetic Map	2	C1.3	NCBI
cM Map	2	35.56	NCBI

Psmd14
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955449	12,305,998 - 12,401,513 (-)	Ensembl
ChiLan1.0	NW_004955449	12,306,026 - 12,400,908 (-)	NCBI	ChiLan1.0	ChiLan1.0

PSMD14
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	63,997,127 - 64,103,767 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	64,014,080 - 64,118,739 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	48,602,395 - 48,705,229 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	165,972,229 - 166,074,879 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	165,972,229 - 166,074,879 (+)	Ensembl			panPan2	panpan1.1

PSMD14
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	6,883,612 - 6,985,291 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	6,889,622 - 6,984,974 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	7,019,712 - 7,122,412 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	7,006,841 - 7,109,577 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	7,006,840 - 7,117,492 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	7,023,304 - 7,125,998 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	7,067,598 - 7,170,265 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	7,175,451 - 7,278,173 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Psmd14
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	124,016,680 - 124,123,583 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936469	17,494,134 - 17,601,045 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936469	17,494,137 - 17,601,045 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSMD14
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	68,162,532 - 68,208,883 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	15	68,107,379 - 68,208,884 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	75,585,422 - 75,707,658 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PSMD14
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	46,703,876 - 46,814,938 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	46,704,098 - 46,815,132 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666040	152,727,806 - 152,837,708 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psmd14
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624732	4,057,810 - 4,150,209 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624732	4,057,519 - 4,150,178 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Psmd14
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	39,350,825 - 39,445,267 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Psmd14
672 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	34
Count of miRNA genes:	28
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000006605
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10401810	Kidm53	Kidney mass QTL 53			kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	28625339	67641995	Rat
2298542	Neuinf11	Neuroinflammation QTL 11	3.9		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	3	35403199	97383526	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
631832	Sach1	Saccharin preference QTL 1	2.7	0.02	consumption behavior trait (VT:0002069)	calculated saccharin drink intake volume (CMO:0001600)	3	47904172	92904172	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
9590286	Uminl1	Urine mineral level QTL 1	3.5	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	3	48657744	93657744	Rat
10450816	Scl75	Serum cholesterol level QTL 75	4.4	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	58601291	71157804	Rat
4889966	Bss95	Bone structure and strength QTL 95	4.4		tibia area (VT:1000281)	tibia-fibula cross-sectional area (CMO:0001718)	3	37796919	82796919	Rat
2313093	Bmd77	Bone mineral density QTL 77	2.2	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	3	47904172	70710963	Rat
12879852	Cm93	Cardiac mass QTL 93		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	3	38708931	67641995	Rat
12879853	Am5	Aortic mass QTL 5		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	3	38708931	67641995	Rat
12879854	Kidm63	Kidney mass QTL 63		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	38708931	67641995	Rat
61356	Bp37	Blood pressure QTL 37	3		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
12879849	Bw180	Body weight QTL 180		0.037	body mass (VT:0001259)	body weight (CMO:0000012)	3	38708931	67641995	Rat
12879850	Cm91	Cardiac mass QTL 91		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	3	38708931	67641995	Rat
2313101	Bmd76	Bone mineral density QTL 76	3.6	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	47904172	70710963	Rat
12879851	Cm92	Cardiac mass QTL 92		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	38708931	67641995	Rat
731172	Bp151	Blood pressure QTL 151		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	67641995	Rat
8694196	Abfw2	Abdominal fat weight QTL 2	16.58	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	48657744	93657744	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	36101403	81101403	Rat
10450852	Stl33	Serum triglyceride level QTL 33	3.4	0.05	blood LDL triglyceride amount (VT:0010699)	blood lipoprotein triglyceride level (CMO:0002685)	3	58601291	71157804	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
4889975	Bmd81	Bone mineral density QTL 81	4.3		tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	3	59119402	70710963	Rat
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
634317	Bw117	Body weight QTL 117	3.58		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight to body weight ratio (CMO:0000095)	3	59863663	73704481	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	59863663	87321459	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	53651826	98651826	Rat
2303593	Gluco46	Glucose level QTL 46	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	48876619	93876619	Rat
1354590	Despr11	Despair related QTL 11		0.000031	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	3	48876619	93876619	Rat
2313079	Bss73	Bone structure and strength QTL 73	1.5		tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	3	47904172	70710963	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	87321459	Rat
631647	Bp122	Blood pressure QTL 122	6.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	51092561	96092561	Rat
2313076	Bss74	Bone structure and strength QTL 74	2	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	3	47904172	70710963	Rat
1300169	Bp177	Blood pressure QTL 177	2.96		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	3	36425116	81425116	Rat
10450813	Scl74	Serum cholesterol level QTL 74	5.8	0.001	blood LDL cholesterol amount (VT:0000181)	blood low density lipoprotein cholesterol level (CMO:0000053)	3	58601291	71157804	Rat
2302276	Bw82	Body weight QTL 82	4.32		body mass (VT:0001259)	body weight (CMO:0000012)	3	59863663	83358329	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	58925062	103925062	Rat
9590136	Scort3	Serum corticosterone level QTL 3	23.37	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	48657744	93657744	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	50766145	95766145	Rat
1558650	Cm48	Cardiac mass QTL 48	4	0.0001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	3	50766145	95766145	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
2325840	Bp345	Blood pressure QTL 345		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	38708931	83708931	Rat
8552950	Pigfal12	Plasma insulin-like growth factor 1 level QTL 12	7.3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	3	48657744	93657744	Rat
631676	Cm8	Cardiac mass QTL 8	7.03	0.0001	aorta mass (VT:0002845)	aorta weight (CMO:0000076)	3	37363734	82363734	Rat
8694386	Bw159	Body weight QTL 159	4.52	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	3	48657744	93657744	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
2313049	Bss72	Bone structure and strength QTL 72	2.6	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	3	47904172	70710963	Rat

Markers in Region

D3Chm12

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	46,273,698 - 46,273,849 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	47,600,592 - 47,600,742	NCBI	Rnor6.0
Rnor_5.0	3	54,272,023 - 54,272,173	UniSTS	Rnor5.0
RGSC_v3.4	3	43,733,914 - 43,734,065	RGD	RGSC3.4
RGSC_v3.4	3	43,733,915 - 43,734,065	UniSTS	RGSC3.4
Celera	3	45,941,287 - 45,941,437	UniSTS
Cytogenetic Map	3	q21	UniSTS

RH143528

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	46,346,812 - 46,346,912 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	47,673,067 - 47,673,166	NCBI	Rnor6.0
Rnor_5.0	3	54,344,623 - 54,344,722	UniSTS	Rnor5.0
RGSC_v3.4	3	43,660,300 - 43,660,399	UniSTS	RGSC3.4
Celera	3	46,014,458 - 46,014,557	UniSTS
Cytogenetic Map	3	q21	UniSTS

AU048604

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	3	66,680,376 - 66,680,598 (+)	Marker Load Pipeline
mRatBN7.2	3	46,271,783 - 46,272,005 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	47,596,977 - 47,597,198	NCBI	Rnor6.0
Rnor_6.0	3	47,598,676 - 47,598,898	NCBI	Rnor6.0
Rnor_5.0	3	54,270,107 - 54,270,329	UniSTS	Rnor5.0
Rnor_5.0	3	54,268,408 - 54,268,629	UniSTS	Rnor5.0
RGSC_v3.4	3	43,735,759 - 43,735,981	UniSTS	RGSC3.4
Celera	3	45,939,372 - 45,939,593	UniSTS
Cytogenetic Map	3	q21	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001025689	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228714	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228827	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000082769 ⟹ ENSRNOP00000071068

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	66,662,900 - 66,755,665 (+)	Ensembl
mRatBN7.2 Ensembl	3	46,254,330 - 46,347,075 (+)	Ensembl
Rnor_6.0 Ensembl	3	47,578,384 - 47,673,338 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096319 ⟹ ENSRNOP00000092641

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	46,254,377 - 46,347,076 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118197 ⟹ ENSRNOP00000087431

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	46,254,368 - 46,347,072 (+)	Ensembl

RefSeq Acc Id:

NM_001025689 ⟹ NP_001020860

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	66,662,933 - 66,755,666 (+)	NCBI
mRatBN7.2	3	46,254,338 - 46,347,076 (+)	NCBI
Rnor_6.0	3	47,578,449 - 47,673,330 (+)	NCBI
Rnor_5.0	3	54,249,938 - 54,344,886 (+)	NCBI
RGSC_v3.4	3	43,660,136 - 43,699,412 (-)	RGD
Celera	3	45,922,238 - 46,014,721 (+)	RGD

Sequence:

show sequence

GTCGGGAACCCGGAAGTACTTCTCAGCAGAGGCCTGGGCGACTCTTTTGAATGGAATCGGGCTG
ATTCATCGCTGTGTCTCCGAGCCAGGTCCTTGTTGATTGTGAGGCGCTGCCCTCGCCGCCGCGT
CGCCACTAGGCCAGGGAGAGAGAGAGAAAAAAAAAACTGCTTGTGGAAAATTGTATCTGCCAGA
ATTAGCAAGAATTGGAGTTAATAAGAAATTTGTCAAATTCAACAAATTGAAGCTTAACTCCATA
AGAATTGCAGTTACTGAACAGAAATATGGACAGACTTCTTAGACTTGGAGGAGGTATGCCTGGA
CTGGGCCAGGGTCCACCTACAGATGCCCCTGCCGTAGACACAGCAGAACAAGTTTACATCTCCT
CCTTGGCGTTGCTAAAGATGTTAAAACATGGCCGTGCTGGGGTTCCTATGGAAGTTATGGGTCT
AATGCTTGGCGAATTTGTTGATGATTACACCGTCAGAGTGATTGATGTGTTTGCTATGCCACAA
TCAGGAACTGGTGTCAGTGTAGAAGCAGTTGATCCAGTGTTCCAAGCCAAAATGTTGGATATGC
TGAAACAAACAGGAAGGCCCGAGATGGTTGTTGGTTGGTATCACAGTCACCCTGGCTTTGGCTG
TTGGCTTTCTGGTGTGGACATCAACACTCAGCAGAGCTTTGAAGCCTTGTCGGAGAGAGCTGTG
GCAGTGGTTGTGGATCCCATTCAGAGTGTGAAAGGAAAGGTTGTTATTGATGCCTTCAGACTGA
TCAATGCTAATATGATGGTCTTAGGACATGAACCGAGACAAACGACTTCCAATCTGGGCCACTT
AAACAAGCCATCTATCCAGGCATTAATTCACGGATTAAACAGACATTACTACTCCATCACTATT
AATTATCGGAAAAATGAACTGGAACAGAAGATGCTGTTAAATTTGCATAAGAAGAGTTGGATGG
AAGGATTGACACTTCAGGACTACAGTGAACATTGTAAACACAATGAATCGGTGGTAAAAGAGAT
GTTGGAATTAGCCAAGAATTATAATAAGGCTGTAGAAGAGGAAGATAAGATGACGCCTGAACAG
CTGGCAATAAAGAATGTGGGCAAGCAGGATCCCAAACGTCATTTGGAAGAGCATGTGGATGTGC
TTATGACTTCAAATATTGTCCAGTGTTTGGCAGCAATGTTGGATACCGTTGTATTTAAATAAAG
CGGAGTAGAGAGCTGTCGGCGACACTCAGTGCATCGTCCTTCCTTGTTCCCAATGCTCATAGTC
ACGGGAACTCTGAAGGTGATCTGGTGACATGAGACGCCTGTGCCACCTCCCATCTCACTTGTGC
AGTTACTTCTGTTTATTTTGTCAGGATTTTGCAGATTCCAAAGTTGTTCAGGAATACATCAAAG
TGAACAAATTTTGTTAAGATCCCATTTACTATTTGAAAAAAATCAGTAGCACAAATATATTTTG
ATTGTTGCTTACAAAATAAAATACATTTACAATCCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001020860	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97427	(Get FASTA)	NCBI Sequence Viewer
	AAI58646	(Get FASTA)	NCBI Sequence Viewer
	EDL78998	(Get FASTA)	NCBI Sequence Viewer
	EDL78999	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071068
	ENSRNOP00000071068.3

RefSeq Acc Id:

NP_001020860 ⟸ NM_001025689

- UniProtKB:

Q4V8E2 (UniProtKB/TrEMBL), F1LMW6 (UniProtKB/TrEMBL), A6HLU7 (UniProtKB/TrEMBL), A0A0G2JZJ1 (UniProtKB/TrEMBL), A0A8I6A8J5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDD
YTVRVIDVFAMPQSGTGVSVEAVDPVFQAKMLDMLKQTGRPEMVVGWYHSHPGFGCWLSGVDIN
TQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQAL
IHGLNRHYYSITINYRKNELEQKMLLNLHKKSWMEGLTLQDYSEHCKHNESVVKEMLELAKNYN
KAVEEEDKMTPEQLAIKNVGKQDPKRHLEEHVDVLMTSNIVQCLAAMLDTVVFK

hide sequence

Ensembl Acc Id:

ENSRNOP00000071068 ⟸ ENSRNOT00000082769

Ensembl Acc Id:

ENSRNOP00000087431 ⟸ ENSRNOT00000118197

Ensembl Acc Id:

ENSRNOP00000092641 ⟸ ENSRNOT00000096319

Protein Domains

MPN

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q4V8E2-F1-model_v2	AlphaFold	Q4V8E2	1-310	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692098

Promoter ID:

EPDNEW_R2622

Type:

initiation region

Name:

Psmd14_1

Description:

proteasome 26S subunit, non-ATPase 14

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	47,578,473 - 47,578,533	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1594532	AgrOrtholog
BioCyc Gene	G2FUF-49600	BioCyc
Ensembl Genes	ENSRNOG00000061129	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000082769	ENTREZGENE
	ENSRNOT00000082769.3	UniProtKB/TrEMBL
Gene3D-CATH	Cytidine Deaminase, domain 2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8363877	IMAGE-MGC_LOAD
InterPro	JAMM_MPN+_peptidase_M67A	UniProtKB/TrEMBL
	Mov34_MPN_PAD1	UniProtKB/TrEMBL
	MPN	UniProtKB/TrEMBL
	RPN11_C	UniProtKB/TrEMBL
KEGG Report	rno:311078	UniProtKB/TrEMBL
MGC_CLONE	MGC:187593	IMAGE-MGC_LOAD
NCBI Gene	311078	ENTREZGENE
PANTHER	EUKARYOTIC TRANSLATION INITIATION FACTOR 3 -RELATED	UniProtKB/TrEMBL
Pfam	Mov34	UniProtKB/TrEMBL
	RPN11_C	UniProtKB/TrEMBL
PhenoGen	Psmd14	PhenoGen
PROSITE	MPN	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000061129	RatGTEx
SMART	JAB_MPN	UniProtKB/TrEMBL
Superfamily-SCOP	JAB1/MPN domain	UniProtKB/TrEMBL
UniProt	A0A0G2JZJ1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A8J5	ENTREZGENE, UniProtKB/TrEMBL
	A6HLU7	ENTREZGENE
	F1LMW6	ENTREZGENE
	Q4V8E2	ENTREZGENE
UniProt Secondary	A6HLU7	UniProtKB/TrEMBL
	F1LMW6	UniProtKB/TrEMBL
	Q4V8E2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-19	Psmd14	proteasome 26S subunit, non-ATPase 14	Psmd14	proteasome (prosome, macropain) 26S subunit, non-ATPase, 14	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-15	Psmd14	proteasome (prosome, macropain) 26S subunit, non-ATPase, 14	Psmd14_predicted	proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (predicted)	Data merged from RGD:1306417	1643240	APPROVED
2008-03-05	Psmd14	proteasome (prosome, macropain) 26S subunit, non-ATPase, 14	LOC311078	similar to T-Brain-1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC311078	similar to T-Brain-1			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-01-12	Psmd14_predicted	proteasome (prosome, macropain) 26S subunit, non-ATPase, 14 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)