Symbol:
Rbpj
Name:
recombination signal binding protein for immunoglobulin kappa J region
RGD ID:
1593096
Description:
Predicted to enable several functions, including DNA-binding transcription activator activity, RNA polymerase II-specific; RNA polymerase II cis-regulatory region sequence-specific DNA binding activity; and RNA polymerase II-specific DNA-binding transcription factor binding activity. Involved in several processes, including negative regulation of smooth muscle cell apoptotic process; negative regulation of smooth muscle cell migration; and positive regulation of smooth muscle cell proliferation. Part of protein-DNA complex. Human ortholog(s) of this gene implicated in Adams-Oliver syndrome and dilated cardiomyopathy. Orthologous to human RBPJ (recombination signal binding protein for immunoglobulin kappa J region); PARTICIPATES IN Notch signaling pathway; Notch signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3-methylfuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
INFERRED
Previously known as:
LOC679028; recombining binding protein suppressor of hairless; similar to Recombining binding protein suppressor of hairless (J kappa-recombination signal binding protein) (RBP-J kappa)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Related Pseudogenes:
Rbpjl2
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 61,551,366 - 61,736,220 (-) NCBI GRCr8 mRatBN7.2 14 57,338,493 - 57,523,330 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 57,338,507 - 57,523,353 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 61,746,363 - 61,809,045 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 63,048,700 - 63,111,484 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 59,445,481 - 59,508,257 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 59,657,738 - 59,865,427 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 59,658,935 - 59,735,450 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 59,785,053 - 59,859,229 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 14 56,447,546 - 56,510,235 (-) NCBI Celera Cytogenetic Map 14 q11 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Rbpj Rat (-)-alpha-phellandrene increases expression ISO RBPJ (Homo sapiens) 6480464 alpha phellandrene results in increased expression of RBPJ mRNA CTD PMID:25075043 Rbpj Rat 1,2-dimethylhydrazine multiple interactions ISO Rbpj (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RBPJ mRNA CTD PMID:22206623 Rbpj Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO RBPJ (Homo sapiens) 6480464 Dinitrochlorobenzene results in decreased expression of RBPJ mRNA CTD PMID:17374397 Rbpj Rat 17alpha-ethynylestradiol multiple interactions ISO Rbpj (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RBPJ mRNA CTD PMID:17942748 Rbpj Rat 17beta-estradiol multiple interactions ISO Rbpj (Mus musculus) 6480464 Estradiol inhibits the reaction [[Galactose co-treated with Aluminum Chloride] results in increased expression of RBPJ protein] CTD PMID:35537655 Rbpj Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Rbpj (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Rbpj Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Rbpj (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of RBPJ mRNA CTD PMID:19770486 Rbpj Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of RBPJ mRNA CTD PMID:33387578 Rbpj Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of RBPJ mRNA CTD PMID:34747641 Rbpj Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Rbpj (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of RBPJ mRNA CTD PMID:17942748 Rbpj Rat 2,4-diaminotoluene increases expression ISO Rbpj (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of RBPJ mRNA CTD PMID:20713471 Rbpj Rat 3-methylcholanthrene increases expression ISO Rbpj (Mus musculus) 6480464 Methylcholanthrene results in increased expression of RBPJ mRNA CTD PMID:20713471 Rbpj Rat 3-methylfuran increases expression EXP 6480464 3-methylfuran results in increased expression of RBPJ mRNA CTD PMID:38160780 Rbpj Rat 4,4'-diaminodiphenylmethane affects expression ISO Rbpj (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane affects the expression of RBPJ mRNA CTD PMID:18648102 Rbpj Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO RBPJ (Homo sapiens) 6480464 Oxazolone results in decreased expression of RBPJ mRNA CTD PMID:17374397 Rbpj Rat 5-aza-2'-deoxycytidine affects expression ISO RBPJ (Homo sapiens) 6480464 Decitabine affects the expression of RBPJ mRNA CTD PMID:23300844 Rbpj Rat 5-fluorouracil multiple interactions ISO RBPJ (Homo sapiens) 6480464 [Fluorouracil co-treated with irinotecan] results in decreased expression of RBPJ mRNA CTD PMID:16391804 Rbpj Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of RBPJ mRNA CTD PMID:30047161 Rbpj Rat acetylleucyl-leucyl-norleucinal increases expression ISO RBPJ (Homo sapiens) 6480464 acetylleucyl-leucyl-norleucinal results in increased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat acrylamide affects expression EXP 6480464 Acrylamide affects the expression of RBPJ mRNA CTD PMID:28959563 Rbpj Rat all-trans-retinoic acid increases expression ISO RBPJ (Homo sapiens) 6480464 Tretinoin results in increased expression of RBPJ mRNA CTD PMID:33167477 Rbpj Rat alpha-D-galactose multiple interactions ISO Rbpj (Mus musculus) 6480464 [Galactose co-treated with Aluminum Chloride] results in increased expression of RBPJ protein more ... CTD PMID:35537655 Rbpj Rat alpha-phellandrene increases expression ISO RBPJ (Homo sapiens) 6480464 alpha phellandrene results in increased expression of RBPJ mRNA CTD PMID:25075043 Rbpj Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of RBPJ mRNA CTD PMID:30047161 Rbpj Rat ammonium chloride multiple interactions ISO RBPJ (Homo sapiens) 6480464 [PSEN1 protein affects the susceptibility to Ammonium Chloride] affects the reaction [Cycloheximide results in decreased expression of RBPJ protein] and Cycloheximide inhibits the reaction [Ammonium Chloride results in increased expression of RBPJ protein] CTD PMID:22302987 Rbpj Rat ammonium chloride increases expression ISO Rbpj (Mus musculus) 6480464 Ammonium Chloride results in increased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat ammonium chloride increases expression ISO RBPJ (Homo sapiens) 6480464 Ammonium Chloride results in increased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat antirheumatic drug decreases expression ISO RBPJ (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of RBPJ mRNA CTD PMID:24449571 Rbpj Rat aristolochic acid A decreases expression ISO RBPJ (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of RBPJ mRNA CTD PMID:33212167 Rbpj Rat arsane increases methylation ISO RBPJ (Homo sapiens) 6480464 Arsenic results in increased methylation of RBPJ promoter CTD PMID:21291286 Rbpj Rat arsane affects methylation ISO RBPJ (Homo sapiens) 6480464 Arsenic affects the methylation of RBPJ gene CTD PMID:25304211 Rbpj Rat arsenic atom increases methylation ISO RBPJ (Homo sapiens) 6480464 Arsenic results in increased methylation of RBPJ promoter CTD PMID:21291286 Rbpj Rat arsenic atom affects methylation ISO RBPJ (Homo sapiens) 6480464 Arsenic affects the methylation of RBPJ gene CTD PMID:25304211 Rbpj Rat arsenite(3-) increases methylation ISO RBPJ (Homo sapiens) 6480464 arsenite results in increased methylation of RBPJ promoter CTD PMID:23974009 Rbpj Rat benzene increases expression ISO RBPJ (Homo sapiens) 6480464 Benzene results in increased expression of RBPJ mRNA CTD PMID:19162166 Rbpj Rat benzo[a]pyrene increases methylation ISO RBPJ (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of RBPJ 3' UTR CTD PMID:27901495 Rbpj Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of RBPJ mRNA and Benzo(a)pyrene results in increased expression of RBPJ protein CTD PMID:35378083 Rbpj Rat benzo[a]pyrene multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [Dibutyl Phthalate results in increased expression of RBPJ mRNA] more ... CTD PMID:35378083 Rbpj Rat benzo[a]pyrene diol epoxide I decreases expression ISO RBPJ (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Rbpj Rat bis(2-ethylhexyl) phthalate decreases expression ISO Rbpj (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of RBPJ mRNA CTD PMID:33754040 Rbpj Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of RBPJ mRNA CTD PMID:25181051 and PMID:30816183 Rbpj Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of RBPJ gene CTD PMID:28505145 Rbpj Rat bisphenol A affects methylation ISO Rbpj (Mus musculus) 6480464 bisphenol A affects the methylation of RBPJ promoter CTD PMID:27334623 Rbpj Rat butanal decreases expression ISO RBPJ (Homo sapiens) 6480464 butyraldehyde results in decreased expression of RBPJ mRNA CTD PMID:26079696 Rbpj Rat cadmium dichloride increases methylation EXP 6480464 Cadmium Chloride results in increased methylation of RBPJ promoter CTD PMID:22457795 Rbpj Rat cadmium dichloride decreases expression ISO RBPJ (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of RBPJ mRNA CTD PMID:38568856 Rbpj Rat CGP 52608 multiple interactions ISO RBPJ (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to RBPJ gene] CTD PMID:28238834 Rbpj Rat chloroquine increases expression ISO RBPJ (Homo sapiens) 6480464 Chloroquine results in increased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat cisplatin affects expression ISO RBPJ (Homo sapiens) 6480464 Cisplatin affects the expression of RBPJ mRNA CTD PMID:23300844 Rbpj Rat cobalt dichloride multiple interactions ISO RBPJ (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of RBPJ mRNA] CTD PMID:22202117 Rbpj Rat cobalt dichloride increases expression ISO RBPJ (Homo sapiens) 6480464 cobaltous chloride results in increased expression of RBPJ mRNA CTD PMID:19376846 and PMID:22202117 Rbpj Rat cycloheximide decreases expression ISO RBPJ (Homo sapiens) 6480464 Cycloheximide results in decreased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat cycloheximide multiple interactions ISO RBPJ (Homo sapiens) 6480464 [PSEN1 protein affects the susceptibility to Ammonium Chloride] affects the reaction [Cycloheximide results in decreased expression of RBPJ protein] more ... CTD PMID:22302987 Rbpj Rat DAPT multiple interactions EXP 6480464 N-(N-(3 and 5-difluorophenacetyl)alanyl)phenylglycine tert-butyl ester inhibits the reaction [Oxygen deficiency results in increased expression of RBPJ mRNA] CTD PMID:24223152 Rbpj Rat DAPT multiple interactions ISO RBPJ (Homo sapiens) 6480464 N-(N-(3 and 5-difluorophenacetyl)alanyl)phenylglycine tert-butyl ester inhibits the reaction [Cycloheximide results in decreased expression of RBPJ protein] CTD PMID:22302987 Rbpj Rat DAPT increases expression ISO RBPJ (Homo sapiens) 6480464 N-(N-(3 and 5-difluorophenacetyl)alanyl)phenylglycine tert-butyl ester results in increased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of RBPJ mRNA CTD PMID:23640034 Rbpj Rat Dibutyl phosphate affects expression ISO RBPJ (Homo sapiens) 6480464 di-n-butylphosphoric acid affects the expression of RBPJ mRNA CTD PMID:37042841 Rbpj Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of RBPJ mRNA and Dibutyl Phthalate results in increased expression of RBPJ protein CTD PMID:35378083 Rbpj Rat dibutyl phthalate multiple interactions EXP 6480464 Benzo(a)pyrene promotes the reaction [Dibutyl Phthalate results in increased expression of RBPJ mRNA] more ... CTD PMID:35378083 Rbpj Rat dicrotophos decreases expression ISO RBPJ (Homo sapiens) 6480464 dicrotophos results in decreased expression of RBPJ mRNA CTD PMID:28302478 Rbpj Rat dioxygen increases expression ISO Rbpj (Mus musculus) 6480464 Oxygen deficiency results in increased expression of RBPJ protein CTD PMID:24223152 Rbpj Rat dioxygen multiple interactions EXP 6480464 N-(N-(3 and 5-difluorophenacetyl)alanyl)phenylglycine tert-butyl ester inhibits the reaction [Oxygen deficiency results in increased expression of RBPJ mRNA] CTD PMID:24223152 Rbpj Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of RBPJ mRNA CTD PMID:24223152 Rbpj Rat disodium selenite increases expression ISO RBPJ (Homo sapiens) 6480464 Sodium Selenite results in increased expression of RBPJ mRNA CTD PMID:18175754 Rbpj Rat enzalutamide affects expression ISO RBPJ (Homo sapiens) 6480464 enzalutamide affects the expression of RBPJ mRNA CTD PMID:30940724 Rbpj Rat enzyme inhibitor multiple interactions ISO RBPJ (Homo sapiens) 6480464 [Enzyme Inhibitors results in decreased activity of OGA protein] which results in increased O-linked glycosylation of RBPJ protein CTD PMID:23301498 Rbpj Rat ethanol affects expression ISO Rbpj (Mus musculus) 6480464 Ethanol affects the expression of RBPJ mRNA CTD PMID:30319688 Rbpj Rat fenvalerate increases expression EXP 6480464 fenvalerate results in increased expression of RBPJ mRNA CTD PMID:30307764 Rbpj Rat folic acid increases expression ISO Rbpj (Mus musculus) 6480464 Folic Acid results in increased expression of RBPJ mRNA CTD PMID:25629700 Rbpj Rat folic acid multiple interactions ISO Rbpj (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RBPJ mRNA CTD PMID:22206623 Rbpj Rat fulvestrant increases methylation ISO RBPJ (Homo sapiens) 6480464 Fulvestrant results in increased methylation of RBPJ gene CTD PMID:31601247 Rbpj Rat galactose multiple interactions ISO Rbpj (Mus musculus) 6480464 [Galactose co-treated with Aluminum Chloride] results in increased expression of RBPJ protein more ... CTD PMID:35537655 Rbpj Rat glyphosate decreases expression ISO RBPJ (Homo sapiens) 6480464 Glyphosate results in decreased expression of RBPJ mRNA CTD PMID:31295307 Rbpj Rat HT-2 toxin increases expression ISO RBPJ (Homo sapiens) 6480464 HT-2 toxin results in increased expression of RBPJ mRNA CTD PMID:38734200 Rbpj Rat hydrogen peroxide affects expression ISO RBPJ (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of RBPJ mRNA CTD PMID:20044591 and PMID:21179406 Rbpj Rat ionomycin multiple interactions ISO RBPJ (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of RBPJ protein CTD PMID:23134680 Rbpj Rat irinotecan decreases expression ISO RBPJ (Homo sapiens) 6480464 Irinotecan analog results in decreased expression of RBPJ mRNA CTD PMID:18927307 Rbpj Rat irinotecan multiple interactions ISO RBPJ (Homo sapiens) 6480464 [Fluorouracil co-treated with Irinotecan] results in decreased expression of RBPJ mRNA CTD PMID:16391804 Rbpj Rat kaempferol 3-O-beta-D-glucoside multiple interactions ISO Rbpj (Mus musculus) 6480464 astragalin inhibits the reaction [[Galactose co-treated with Aluminum Chloride] results in increased expression of RBPJ protein] CTD PMID:35537655 Rbpj Rat lactacystin increases expression ISO RBPJ (Homo sapiens) 6480464 lactacystin results in increased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat lead diacetate increases methylation EXP 6480464 lead acetate results in increased methylation of RBPJ gene CTD PMID:29571894 Rbpj Rat menadione decreases expression ISO Rbpj (Mus musculus) 6480464 Vitamin K 3 results in decreased expression of RBPJ mRNA CTD PMID:25270620 Rbpj Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of RBPJ mRNA CTD PMID:30047161 Rbpj Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO RBPJ (Homo sapiens) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO RBPJ (Homo sapiens) 6480464 [PSEN1 protein affects the susceptibility to benzyloxycarbonylleucyl-leucyl-leucine aldehyde] affects the reaction [Cycloheximide results in decreased expression of RBPJ protein] and Cycloheximide inhibits the reaction [benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of RBPJ protein] CTD PMID:22302987 Rbpj Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal increases expression ISO Rbpj (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde results in increased expression of RBPJ protein CTD PMID:22302987 Rbpj Rat nickel sulfate decreases expression ISO RBPJ (Homo sapiens) 6480464 nickel sulfate results in decreased expression of RBPJ mRNA CTD PMID:17374397 and PMID:22714537 Rbpj Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RBPJ mRNA CTD PMID:25729387 Rbpj Rat phorbol 13-acetate 12-myristate multiple interactions ISO RBPJ (Homo sapiens) 6480464 [Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased activity of RBPJ protein CTD PMID:23134680 Rbpj Rat pregnenolone 16alpha-carbonitrile decreases expression EXP 6480464 Pregnenolone Carbonitrile results in decreased expression of RBPJ mRNA CTD PMID:30047161 Rbpj Rat quercetin increases expression EXP 6480464 Quercetin results in increased expression of RBPJ mRNA CTD PMID:23117658 Rbpj Rat rimonabant multiple interactions ISO Rbpj (Mus musculus) 6480464 Rimonabant inhibits the reaction [Dietary Fats results in increased expression of RBPJ mRNA] CTD PMID:19030233 Rbpj Rat SB 203580 multiple interactions ISO RBPJ (Homo sapiens) 6480464 [PSEN1 protein affects the susceptibility to SB 203580] affects the reaction [Cycloheximide results in decreased expression of RBPJ protein] CTD PMID:22302987 Rbpj Rat silicon dioxide increases expression EXP 6480464 Silicon Dioxide results in increased expression of RBPJ mRNA CTD PMID:18685790 Rbpj Rat sodium arsenite affects expression ISO RBPJ (Homo sapiens) 6480464 sodium arsenite affects the expression of RBPJ mRNA CTD PMID:29319823 Rbpj Rat Soman increases expression EXP 6480464 Soman results in increased expression of RBPJ mRNA CTD PMID:19281266 Rbpj Rat sulfadimethoxine decreases expression EXP 6480464 Sulfadimethoxine results in decreased expression of RBPJ mRNA CTD PMID:30047161 Rbpj Rat sunitinib increases expression ISO RBPJ (Homo sapiens) 6480464 Sunitinib results in increased expression of RBPJ mRNA CTD PMID:31533062 Rbpj Rat thimerosal decreases expression ISO Rbpj (Mus musculus) 6480464 Thimerosal results in decreased expression of RBPJ mRNA CTD PMID:24675092 Rbpj Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of RBPJ mRNA CTD PMID:34492290 Rbpj Rat titanium dioxide increases expression ISO Rbpj (Mus musculus) 6480464 titanium dioxide results in increased expression of RBPJ mRNA CTD PMID:35295148 Rbpj Rat titanium dioxide decreases methylation ISO Rbpj (Mus musculus) 6480464 titanium dioxide results in decreased methylation of RBPJ promoter CTD PMID:35295148 Rbpj Rat titanium dioxide increases methylation ISO Rbpj (Mus musculus) 6480464 titanium dioxide results in increased methylation of RBPJ gene CTD PMID:35295148 Rbpj Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of RBPJ mRNA CTD PMID:25729387 Rbpj Rat triclosan decreases expression ISO Rbpj (Mus musculus) 6480464 Triclosan results in decreased expression of RBPJ mRNA and Triclosan results in decreased expression of RBPJ protein CTD PMID:36243240 Rbpj Rat triphenyl phosphate affects expression ISO RBPJ (Homo sapiens) 6480464 triphenyl phosphate affects the expression of RBPJ mRNA CTD PMID:37042841 Rbpj Rat triptonide decreases expression ISO RBPJ (Homo sapiens) 6480464 triptonide results in decreased expression of RBPJ protein CTD PMID:31866380 Rbpj Rat triticonazole decreases expression EXP 6480464 triticonazole results in decreased expression of RBPJ mRNA CTD PMID:36084822 Rbpj Rat troglitazone decreases expression ISO Rbpj (Mus musculus) 6480464 troglitazone results in decreased expression of RBPJ mRNA CTD PMID:28973697 Rbpj Rat valproic acid affects expression ISO RBPJ (Homo sapiens) 6480464 Valproic Acid affects the expression of RBPJ mRNA CTD PMID:25979313 Rbpj Rat valproic acid decreases expression ISO RBPJ (Homo sapiens) 6480464 Valproic Acid results in decreased expression of RBPJ mRNA CTD PMID:23179753 more ... Rbpj Rat zinc dichloride multiple interactions ISO RBPJ (Homo sapiens) 6480464 zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of RBPJ mRNA] CTD PMID:22202117
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
(-)-alpha-phellandrene (ISO) 1,2-dimethylhydrazine (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (ISO) 3-methylcholanthrene (ISO) 3-methylfuran (EXP) 4,4'-diaminodiphenylmethane (ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetylleucyl-leucyl-norleucinal (ISO) acrylamide (EXP) all-trans-retinoic acid (ISO) alpha-D-galactose (ISO) alpha-phellandrene (ISO) amitrole (EXP) ammonium chloride (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) butanal (ISO) cadmium dichloride (EXP,ISO) CGP 52608 (ISO) chloroquine (ISO) cisplatin (ISO) cobalt dichloride (ISO) cycloheximide (ISO) DAPT (EXP,ISO) decabromodiphenyl ether (EXP) Dibutyl phosphate (ISO) dibutyl phthalate (EXP) dicrotophos (ISO) dioxygen (EXP,ISO) disodium selenite (ISO) enzalutamide (ISO) enzyme inhibitor (ISO) ethanol (ISO) fenvalerate (EXP) folic acid (ISO) fulvestrant (ISO) galactose (ISO) glyphosate (ISO) HT-2 toxin (ISO) hydrogen peroxide (ISO) ionomycin (ISO) irinotecan (ISO) kaempferol 3-O-beta-D-glucoside (ISO) lactacystin (ISO) lead diacetate (EXP) menadione (ISO) methimazole (EXP) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) nickel sulfate (ISO) oxaliplatin (EXP) phorbol 13-acetate 12-myristate (ISO) pregnenolone 16alpha-carbonitrile (EXP) quercetin (EXP) rimonabant (ISO) SB 203580 (ISO) silicon dioxide (EXP) sodium arsenite (ISO) Soman (EXP) sulfadimethoxine (EXP) sunitinib (ISO) thimerosal (ISO) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) triclosan (ISO) triphenyl phosphate (ISO) triptonide (ISO) triticonazole (EXP) troglitazone (ISO) valproic acid (ISO) zinc dichloride (ISO)
1.
Inhibition of Notch signaling promotes browning of white adipose tissue and ameliorates obesity.
Bi P, etal., Nat Med. 2014 Aug;20(8):911-8. doi: 10.1038/nm.3615. Epub 2014 Jul 20.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Genetic elements regulating HES-1 induction in Wnt-1-transformed PC12 cells.
Issack PS and Ziff EB, Cell Growth Differ. 1998 Oct;9(10):827-36.
4.
Characterization of a high-molecular-weight Notch complex in the nucleus of Notch(ic)-transformed RKE cells and in a human T-cell leukemia cell line.
Jeffries S, etal., Mol Cell Biol. 2002 Jun;22(11):3927-41.
5.
Functional interactions between an atypical NF-kappaB site from the rat CYP2B1 promoter and the transcriptional repressor RBP-Jkappa/CBF1.
Lee SH, etal., Nucleic Acids Res. 2000 May 15;28(10):2091-8.
6.
Notch signaling inhibits PC12 cell neurite outgrowth via RBP-J-dependent and -independent mechanisms.
Levy OA, etal., Dev Neurosci. 2002;24(1):79-88.
7.
Enhanced expression and autoimmunity of recombination signal binding protein-jkappa in human dilated cardiomyopathy.
Nickenig G, etal., Biochem Biophys Res Commun. 1999 Dec 20;266(2):432-6.
8.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
9.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
10.
PID Annotation Import Pipeline
Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
13.
Notch 1 and 3 receptor signaling modulates vascular smooth muscle cell growth, apoptosis, and migration via a CBF-1/RBP-Jk dependent pathway.
Sweeney C, etal., FASEB J. 2004 Sep;18(12):1421-3. Epub 2004 Jul 9.
Rbpj Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 14 61,551,366 - 61,736,220 (-) NCBI GRCr8 mRatBN7.2 14 57,338,493 - 57,523,330 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 14 57,338,507 - 57,523,353 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 14 61,746,363 - 61,809,045 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 14 63,048,700 - 63,111,484 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 14 59,445,481 - 59,508,257 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 14 59,657,738 - 59,865,427 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 14 59,658,935 - 59,735,450 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 14 59,785,053 - 59,859,229 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 14 56,447,546 - 56,510,235 (-) NCBI Celera Cytogenetic Map 14 q11 NCBI
RBPJ Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 4 26,105,449 - 26,435,131 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 4 26,163,455 - 26,435,131 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 4 26,165,080 - 26,436,753 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 4 25,930,430 - 26,042,376 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 4 26,771,681 - 26,884,040 (+) NCBI Celera Cytogenetic Map 4 p15.2 NCBI HuRef 4 25,659,979 - 25,775,063 (+) NCBI HuRef CHM1_1 4 26,322,549 - 26,437,875 (+) NCBI CHM1_1 T2T-CHM13v2.0 4 26,087,631 - 26,420,111 (+) NCBI T2T-CHM13v2.0
Rbpj Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 5 53,713,121 - 53,814,787 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 5 53,623,494 - 53,814,704 (+) Ensembl GRCm39 Ensembl GRCm38 5 53,555,779 - 53,657,445 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 5 53,466,152 - 53,657,362 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 5 53,947,018 - 54,048,684 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 5 53,878,593 - 53,944,281 (+) NCBI MGSCv36 mm8 Celera 5 50,938,216 - 51,041,035 (+) NCBI Celera Cytogenetic Map 5 C1 NCBI cM Map 5 29.37 NCBI
Rbpj Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955443 18,783,061 - 18,910,228 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955443 18,783,061 - 19,029,441 (-) NCBI ChiLan1.0 ChiLan1.0
RBPJ Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 3 26,573,771 - 26,689,708 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 4 26,766,523 - 26,881,531 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 4 20,719,548 - 20,835,439 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 4 25,996,223 - 26,107,683 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 4 25,995,263 - 26,107,683 (+) Ensembl panpan1.1 panPan2
RBPJ Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 3 84,060,417 - 84,286,008 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 3 84,064,440 - 84,286,360 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 3 86,572,469 - 86,797,897 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 3 85,030,006 - 85,255,529 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 3 85,034,041 - 85,255,924 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 3 84,151,949 - 84,377,265 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 3 84,271,690 - 84,496,976 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 3 84,656,440 - 84,881,337 (-) NCBI UU_Cfam_GSD_1.0
Rbpj Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024405285 49,648,938 - 49,859,262 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936477 3,349,627 - 3,461,797 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936477 3,354,336 - 3,445,248 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
RBPJ Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 8 19,922,779 - 20,166,754 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 8 19,933,035 - 20,166,746 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 8 20,306,820 - 20,540,623 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
RBPJ
Rbpj
.
Predicted Target Of
Count of predictions: 378 Count of miRNA genes: 217 Interacting mature miRNAs: 273 Transcripts: ENSRNOT00000071929 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
2313089 Bss81 Bone structure and strength QTL 81 3.4 0.0001 body length (VT:0001256) body length, nose to rump (CMO:0000079) 14 37669719 82669719 Rat 1581500 Renag1 Renal agenesis QTL 1 kidney development trait (VT:0000527) percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940) 14 8170668 68298175 Rat 9590294 Uminl4 Urine mineral level QTL 4 5.66 0.001 urine mineral amount (VT:0015086) urine electrolyte level (CMO:0000593) 14 55624247 100624247 Rat 2300197 Scl59 Serum cholesterol level QTL 59 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 55147478 100147478 Rat 10755459 Coatc15 Coat color QTL 15 0.01681 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 14 19836944 64836944 Rat 70214 Niddm28 Non-insulin dependent diabetes mellitus QTL 28 4.06 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 14 39998251 75582726 Rat 1300154 Bp189 Blood pressure QTL 189 3.04 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 14 30883777 68757901 Rat 70187 Pancm5 Pancreatic morphology QTL 5 16.7 pancreas mass (VT:0010144) pancreas weight to body weight ratio (CMO:0000630) 14 30320092 80829842 Rat 631523 Pia13 Pristane induced arthritis QTL 13 3.3 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 14 40793460 98037301 Rat 2313100 Bss82 Bone structure and strength QTL 82 3 0.0001 tibia size trait (VT:0100001) tibia midshaft cross-sectional area (CMO:0001717) 14 37669719 82669719 Rat 7387267 Uae42 Urinary albumin excretion QTL 42 0.61 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 14 22167967 67167967 Rat 2317879 Alcrsp27 Alcohol response QTL 27 3.3 0.63 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 14 56631369 101631369 Rat 631839 Niddm37 Non-insulin dependent diabetes mellitus QTL 37 3.37 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 14 11030622 95876975 Rat 2313397 Coatc1 Coat color QTL1 coat/hair pigmentation trait (VT:0010463) coat/hair color measurement (CMO:0001808) 14 18541332 63541332 Rat 9589034 Epfw11 Epididymal fat weight QTL 11 6 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 14 55624247 100624247 Rat 2313048 Bss84 Bone structure and strength QTL 84 3.1 0.0001 tibia strength trait (VT:1000284) tibia total energy absorbed before break (CMO:0001736) 14 37669719 82669719 Rat 1300136 Rf22 Renal function QTL 22 3.9 renal blood flow trait (VT:2000006) absolute change in renal vascular resistance (CMO:0001900) 14 42262529 95023211 Rat 1549834 Scl45 Serum cholesterol level QTL 45 5.8 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 14 50023211 95023211 Rat 738037 Hcas6 Hepatocarcinoma susceptibility QTL 6 2.93 liver integrity trait (VT:0010547) liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464) 14 39057237 83368335 Rat 2313084 Bss83 Bone structure and strength QTL 83 2.9 0.0001 tibia size trait (VT:0100001) tibia midshaft endosteal cross-sectional area (CMO:0001716) 14 37669719 82669719 Rat
D14Got163
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 57,378,908 - 57,379,048 (+) MAPPER mRatBN7.2 Rnor_6.0 14 59,712,144 - 59,712,283 NCBI Rnor6.0 Rnor_5.0 14 59,836,103 - 59,836,242 UniSTS Rnor5.0 RGSC_v3.4 14 62,296,273 - 62,296,412 UniSTS RGSC3.4 Celera 14 56,486,697 - 56,486,835 UniSTS Cytogenetic Map 14 RGD
Rbpsuh-rs3
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 5,465,228 - 5,465,852 (+) MAPPER mRatBN7.2 Rnor_6.0 5 4,878,500 - 4,879,123 NCBI Rnor6.0 Rnor_5.0 5 4,847,450 - 4,848,073 UniSTS Rnor5.0 RGSC_v3.4 5 4,664,368 - 4,664,991 UniSTS RGSC3.4 Celera 5 5,053,895 - 5,054,518 UniSTS Cytogenetic Map 5 q11 UniSTS
X17459
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 57,342,105 - 57,342,263 (+) MAPPER mRatBN7.2 Rnor_6.0 14 59,661,351 - 59,661,508 NCBI Rnor6.0 Rnor_5.0 14 59,787,469 - 59,787,626 UniSTS Rnor5.0 Celera 14 56,449,963 - 56,450,120 UniSTS
UniSTS:465469
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 14 57,342,788 - 57,343,333 (+) MAPPER mRatBN7.2 Rnor_6.0 14 59,662,034 - 59,662,578 NCBI Rnor6.0 Rnor_5.0 14 59,788,152 - 59,788,696 UniSTS Rnor5.0 Celera 14 56,450,646 - 56,451,190 UniSTS
Rbpj
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 5,465,633 - 5,466,132 (+) MAPPER mRatBN7.2 Rnor_6.0 5 4,878,905 - 4,879,403 NCBI Rnor6.0 Rnor_5.0 5 4,847,855 - 4,848,353 UniSTS Rnor5.0 RGSC_v3.4 5 4,664,773 - 4,665,271 UniSTS RGSC3.4 Celera 5 5,054,300 - 5,054,798 UniSTS Cytogenetic Map 5 q11 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000071929 ⟹ ENSRNOP00000065485
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 57,338,511 - 57,402,233 (-) Ensembl Rnor_6.0 Ensembl 14 59,658,935 - 59,735,450 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000103399 ⟹ ENSRNOP00000095583
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 57,338,507 - 57,523,353 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000106059 ⟹ ENSRNOP00000093992
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 57,338,507 - 57,385,814 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000117966 ⟹ ENSRNOP00000081140
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 57,338,507 - 57,402,684 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118409 ⟹ ENSRNOP00000093252
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 14 57,338,507 - 57,434,555 (-) Ensembl
RefSeq Acc Id:
NM_001106631 ⟹ NP_001100101
RefSeq Status:
INFERRED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,552,560 - 61,615,438 (-) NCBI mRatBN7.2 14 57,339,690 - 57,402,574 (-) NCBI Rnor_6.0 14 59,658,935 - 59,735,450 (-) NCBI Rnor_5.0 14 59,785,053 - 59,859,229 (-) NCBI Celera 14 56,447,546 - 56,510,235 (-) RGD
Sequence:
TAGTAATGCCCTCCGGTTTTCCTCAGTCTCCACGTACGTCCCCGAGGGCGCGTCCCAAAACCCGGATAACCGGAGCGCTCCCCATGGACTACACGAAGGGCTCGTCCGCGGAGGAGCGGCCTGCGCAT
hide sequence
RefSeq Acc Id:
NM_001414973 ⟹ NP_001401902
RefSeq Status:
INFERRED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,551,366 - 61,615,260 (-) NCBI mRatBN7.2 14 57,338,496 - 57,402,396 (-) NCBI
RefSeq Acc Id:
XM_039092403 ⟹ XP_038948331
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,551,375 - 61,736,220 (-) NCBI mRatBN7.2 14 57,340,056 - 57,523,329 (-) NCBI
RefSeq Acc Id:
XM_039092405 ⟹ XP_038948333
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,551,375 - 61,615,238 (-) NCBI mRatBN7.2 14 57,340,056 - 57,402,324 (-) NCBI
RefSeq Acc Id:
XM_039092406 ⟹ XP_038948334
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,551,375 - 61,736,218 (-) NCBI mRatBN7.2 14 57,340,056 - 57,523,330 (-) NCBI
RefSeq Acc Id:
XM_039092407 ⟹ XP_038948335
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,551,375 - 61,615,014 (-) NCBI mRatBN7.2 14 57,339,813 - 57,402,148 (-) NCBI
RefSeq Acc Id:
XM_039092408 ⟹ XP_038948336
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,551,375 - 61,616,484 (-) NCBI mRatBN7.2 14 57,340,056 - 57,403,621 (-) NCBI
RefSeq Acc Id:
XM_063273584 ⟹ XP_063129654
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,551,375 - 61,616,408 (-) NCBI
RefSeq Acc Id:
XM_063273585 ⟹ XP_063129655
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 14 61,551,375 - 61,592,371 (-) NCBI
RefSeq Acc Id:
NP_001100101 ⟸ NM_001106631
- Peptide Label:
isoform 1
- UniProtKB:
A6IJF7 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
- Sequence:
MRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVYLMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSDKRKHFMLSVKMFYGNSDDIGVFLSKRIKV
hide sequence
Ensembl Acc Id:
ENSRNOP00000065485 ⟸ ENSRNOT00000071929
RefSeq Acc Id:
XP_038948335 ⟸ XM_039092407
- Peptide Label:
isoform X4
- UniProtKB:
A6IJF7 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948334 ⟸ XM_039092406
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AL64 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948331 ⟸ XM_039092403
- Peptide Label:
isoform X2
- UniProtKB:
A0A8I6AN87 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948336 ⟸ XM_039092408
- Peptide Label:
isoform X4
- UniProtKB:
A6IJF7 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038948333 ⟸ XM_039092405
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AL64 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000093992 ⟸ ENSRNOT00000106059
Ensembl Acc Id:
ENSRNOP00000093252 ⟸ ENSRNOT00000118409
Ensembl Acc Id:
ENSRNOP00000081140 ⟸ ENSRNOT00000117966
Ensembl Acc Id:
ENSRNOP00000095583 ⟸ ENSRNOT00000103399
RefSeq Acc Id:
NP_001401902 ⟸ NM_001414973
- Peptide Label:
isoform 2
- UniProtKB:
M0R7Q3 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129654 ⟸ XM_063273584
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I5ZUF4 (UniProtKB/TrEMBL), A6IJF6 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063129655 ⟸ XM_063273585
- Peptide Label:
isoform X3
- UniProtKB:
A0A8I6AL64 (UniProtKB/TrEMBL), A0A8I6AFG7 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2009-04-14
Rbpj
recombination signal binding protein for immunoglobulin kappa J region
LOC679028
similar to Recombining binding protein suppressor of hairless (J kappa-recombination signal binding protein) (RBP-J kappa)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-20
LOC679028
similar to Recombining binding protein suppressor of hairless (J kappa-recombination signal binding protein) (RBP-J kappa)
Symbol and Name status set to provisional
70820 PROVISIONAL
