Advanced Search (OLGA)

Gene: Ap3s2 (adaptor related protein complex 3 subunit sigma 2) Rattus norvegicus

Analyze

Symbol:

Ap3s2

Name:

adaptor related protein complex 3 subunit sigma 2

RGD ID:

1586888

Description:

Predicted to be involved in anterograde synaptic vesicle transport. Is active in synaptic vesicle. Orthologous to human AP3S2 (adaptor related protein complex 3 subunit sigma 2); INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 2,3,7,8-tetrachlorodibenzodioxine; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

adaptor-related protein complex 3, sigma 2 subunit; AP-3 complex subunit sigma-2; hypothetical protein LOC683402; LOC683402; similar to AP-3 complex subunit sigma-2 (Adapter-related protein complex 3 sigma-2 subunit) (Sigma-adaptin 3b) (AP-3 complex sigma-3B subunit) (Sigma-3B-adaptin); uncharacterized protein LOC683402

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AP3S2 (adaptor related protein complex 3 subunit sigma 2)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ap3s2 (adaptor-related protein complex 3, sigma 2 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AP3S2 (adaptor related protein complex 3 subunit sigma 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AP3S2 (adaptor related protein complex 3 subunit sigma 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ap3s2 (adaptor related protein complex 3 subunit sigma 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AP3S2 (adaptor-related protein complex 3, sigma 2 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ARPIN-AP3S2 (ARPIN-AP3S2 readthrough)	HGNC	EggNOG, Treefam
Homo sapiens (human):	AP3S1 (adaptor related protein complex 3 subunit sigma 1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	AP3S2 (adaptor related protein complex 3 subunit sigma 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	AP3S2 (adaptor related protein complex 3 subunit sigma 2)	Alliance	DIOPT (HGNC\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ap3s2 (adaptor-related protein complex 3, sigma 2 subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ap3s2 (adaptor-related protein complex 3, sigma 2 subunit)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ap3s2 (adaptor related protein complex 3 subunit sigma 2)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ap3s2 (adaptor related protein complex 3 subunit sigma 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	APS3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	APS3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	aps-3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	aps-3	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	or	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	or	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ap3s2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ap3s2	Alliance	DIOPT (OMA\|OrthoFinder\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	143,228,131 - 143,268,573 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	143,228,135 - 143,268,573 (-)	Ensembl				GRCr8
mRatBN7.2	1	133,818,825 - 133,859,269 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	133,818,825 - 133,859,322 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	141,728,397 - 141,768,822 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	148,897,804 - 148,938,229 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	141,815,521 - 141,855,945 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	141,612,961 - 141,655,417 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	141,612,963 - 141,655,894 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	142,574,433 - 142,615,225 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	135,653,104 - 135,689,454 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	125,881,750 - 125,917,424 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

type 2 diabetes mellitus (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,3,5-trinitro-1,3,5-triazinane (EXP)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

acrylamide (EXP)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bisphenol A (EXP)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dorsomorphin (ISO)

hypochlorous acid (ISO)

indometacin (ISO)

isotretinoin (ISO)

okadaic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pirinixic acid (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

thioacetamide (EXP)

tributylstannane (EXP)

triphenyl phosphate (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

anterograde axonal transport (IEA,ISO)

anterograde synaptic vesicle transport (IEA,ISO)

Golgi to vacuole transport (IEA)

intracellular protein transport (IEA)

protein transport (IEA)

vesicle-mediated transport (IEA)

Cellular Component

AP-3 adaptor complex (IEA,ISO)

axon cytoplasm (IEA)

cytoplasmic vesicle (IEA)

cytoplasmic vesicle membrane (IEA)

Golgi apparatus (IEA)

membrane coat (IEA)

synaptic vesicle (EXP,IDA)

trans-Golgi network (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Hidden proteome of synaptic vesicles in the mammalian brain.	Taoufiq Z, etal., Proc Natl Acad Sci U S A. 2020 Dec 29;117(52):33586-33596. doi: 10.1073/pnas.2011870117. Epub 2020 Dec 21.

Additional References at PubMed

PMID:9118953	PMID:12477932	PMID:21998198

Genomics

Comparative Map Data

Ap3s2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	143,228,131 - 143,268,573 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	143,228,135 - 143,268,573 (-)	Ensembl				GRCr8
mRatBN7.2	1	133,818,825 - 133,859,269 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	133,818,825 - 133,859,322 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	141,728,397 - 141,768,822 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	148,897,804 - 148,938,229 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	141,815,521 - 141,855,945 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	141,612,961 - 141,655,417 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	141,612,963 - 141,655,894 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	142,574,433 - 142,615,225 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	135,653,104 - 135,689,454 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	125,881,750 - 125,917,424 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

AP3S2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	89,830,599 - 89,893,994 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	89,830,599 - 89,894,638 (-)	Ensembl			hg38	GRCh38
GRCh37	15	90,373,831 - 90,437,226 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	88,177,792 - 88,238,206 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	88,177,792 - 88,238,206	NCBI
Celera	15	66,776,618 - 66,840,633 (-)	NCBI		Celera
Cytogenetic Map	15	q26.1	NCBI
HuRef	15	66,486,975 - 66,549,513 (-)	NCBI		HuRef
CHM1_1	15	90,214,856 - 90,279,356 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	87,586,470 - 87,650,001 (-)	NCBI		T2T-CHM13v2.0

Ap3s2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	79,525,073 - 79,570,388 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	79,525,073 - 79,570,397 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	79,875,325 - 79,920,640 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	79,875,325 - 79,920,649 (-)	Ensembl			mm10	GRCm38
MGSCv37	7	87,020,211 - 87,065,526 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	79,748,838 - 79,794,114 (-)	NCBI		MGSCv36	mm8
Celera	7	77,274,187 - 77,319,524 (-)	NCBI		Celera
Cytogenetic Map	7	D2	NCBI
cM Map	7	45.23	NCBI

AP3S2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	79,384,158 - 79,441,788 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	83,086,501 - 83,142,705 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	68,524,982 - 68,583,917 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	87,727,539 - 87,786,121 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

AP3S2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	52,807,462 - 52,865,290 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	52,807,462 - 52,865,245 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	55,441,326 - 55,498,112 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	53,224,171 - 53,281,084 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	53,222,853 - 53,281,066 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	52,745,895 - 52,802,647 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	52,955,926 - 53,012,923 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	53,296,286 - 53,353,136 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ap3s2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	130,673,609 - 130,724,763 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	15,613,474 - 15,660,838 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	15,613,474 - 15,660,862 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AP3S2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	55,391,913 - 55,469,858 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	55,395,159 - 55,462,352 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	60,284,224 - 60,346,605 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Ap3s2
241 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	106
Count of miRNA genes:	85
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000068084
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	131179947	176179947	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	137611478	182611478	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	132760429	191848948	Rat
631684	Bp117	Blood pressure QTL 117	8.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	120082258	165082258	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	112521556	157521556	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	142582336	182383862	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	130419227	175419227	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132889797	152403053	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	132966869	252856240	Rat
61341	Bp26	Blood pressure QTL 26			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	139442053	223964440	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	127329268	206393015	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	142582180	153680016	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	124975316	152612788	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	141173126	169168317	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
631206	Niddm40	Non-insulin dependent diabetes mellitus QTL 40			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	140833106	185833106	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	131243790	176243790	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat
737974	Bp161	Blood pressure QTL 161		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	129182274	174182274	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	132760429	191848948	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	176289080	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	128019551	173019551	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	108680016	153680016	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
724562	Rends1	Renal damage susceptibility QTL 1		0.05	kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	1	139442053	223964440	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	143092939	188092939	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	178317588	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	112521556	157521556	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	140048073	185048073	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	111949780	160574007	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	135021436	180021436	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	191190115	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	132966869	206393015	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	132760429	152404087	Rat
631548	Bp88	Blood pressure QTL 88	5	0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	140915717	185915717	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	132760429	191848948	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat

Markers in Region

RH140954

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	133,819,001 - 133,819,182 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	141,613,138 - 141,613,318	NCBI	Rnor6.0
Rnor_5.0	1	142,574,610 - 142,574,790	UniSTS	Rnor5.0
RGSC_v3.4	1	135,653,281 - 135,653,461	UniSTS	RGSC3.4
Celera	1	125,881,927 - 125,882,107	UniSTS
RH 3.4 Map	1	1066.8	UniSTS
Cytogenetic Map	1	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001115039	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158881	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000068084 ⟹ ENSRNOP00000062692

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	143,228,135 - 143,264,488 (-)	Ensembl
mRatBN7.2 Ensembl	1	133,818,825 - 133,855,184 (-)	Ensembl
Rnor_6.0 Ensembl	1	141,612,963 - 141,655,417 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000082591 ⟹ ENSRNOP00000072451

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	143,228,135 - 143,268,573 (-)	Ensembl
mRatBN7.2 Ensembl	1	133,821,191 - 133,859,232 (-)	Ensembl
Rnor_6.0 Ensembl	1	141,613,661 - 141,655,894 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096941 ⟹ ENSRNOP00000088313

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	143,228,135 - 143,268,573 (-)	Ensembl
mRatBN7.2 Ensembl	1	133,818,825 - 133,859,322 (-)	Ensembl

RefSeq Acc Id:

NM_001115039 ⟹ NP_001108511

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,228,131 - 143,268,573 (-)	NCBI
mRatBN7.2	1	133,818,825 - 133,859,269 (-)	NCBI
Rnor_6.0	1	141,612,961 - 141,655,417 (-)	NCBI
Rnor_5.0	1	142,574,433 - 142,615,225 (-)	NCBI
RGSC_v3.4	1	135,653,104 - 135,689,454 (-)	RGD
Celera	1	125,881,750 - 125,917,424 (-)	RGD

Sequence:

show sequence

GGAGCAGCCGGTGCCGAGAGAAGCGGGACCGGCAAAGATGATTCAGGCGATTCTGGTTTTCAAC
AACCATGGGAAACCGCGGCTGGTCCGCTTCTACCAGCGTTTTCCAGAAGAAATTCAACAGCAGA
TTGTTCGAGAGACCTTCCACCTGGTCCTCAAGCGAGATGACAACATCTGTAACTTCTTAGAAGG
TGGAAGTTTGATTGGTGGCTCTGACTACAAACTGATTTACCGGCACTATGCTACCCTCTACTTC
GTGTTTTGTGTGGATTCATCAGAGAGTGAACTTGGGATCTTGGACCTCATCCAGGTTTTTGTGG
AGACTCTGGATAAGTGTTTTGAAAATGTCTGTGAGTTGGACTTGATCTTCCATATGGATAAGGT
GCACTACATCCTCCAGGAGGTGGTGATGGGTGGGATGGTGTTGGAAACAAACATGAATGAGATC
GTGGCTCAAATTGAAGCTCAAAACAGGCTGGAGAAGTCGGAGGGTGGCCTTTCAGCAGCCCCTG
CAAGGGCCGTGTCCGCTGTGAAGAACATCAACCTTCCCGAGATCCCCAGGAACATCAACATCGG
CGATCTCAACATCAAAGTTCCCAACCTGTCTCAGTTTGTGTGAAGGTGGAGGACTGGGCTGAAC
TGGAGTTCTTAGGATGAGCAAAGCAAAGTCCAGAAGCAGAACCCTGTTGAGCCTTTAGAGTCGC
AGCTTGGGACCCTGAGCCTTTCACAGAGTGGGAAGGGAGTTGAGTGCACACTGCCTGGCCATCC
TGCTGCTCTCTGATACACGCGGCTGTGGTAGGCATCAGGGCACTAAGCCACTGCTCTTTTGCCT
CCCCCACACAGCTGCCCTCAGGGCCAGGGACTGGAACAAGCCACCTGCTTCCCAGGGCCCCACC
GATGGGACTGAACACATCTGACTTCCTCTCTAGCACCAAGGGCCGCTGAGATCCTGTATCACTT
ACTGGGCAAGAGACTAGGGAGAAGGGCCAGCTGTTAGCTGTCAGGCATGCAGGTGAGGGCAGGG
CAGATGCTGCTTCTGCCTCTGTGCCCTTTGTATGGCCAAGCATTGTGGTCCACAGTTGCCTCGG
AGCAGTTTCCTCACTAGCATGTTCCTAGTCTTGTGGTCAGAGGCATCTGTATGCTGGGGTTTAA
GTCACACCCTGGGTGCATGCCACCACTACACACACAAACACACACCGGGGTGGGGACCCCAGAA
CCCTCTCCAGAGGAGAGACCAGTGTCTGTGGAATGTGATGGCTGAATCCTTCCCGGGTTATGAC
TCTTTCCAAGTTTGAAATACAGTTTTCCTGGAAGCAGAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001108511	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58882	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000062692.3
	ENSRNOP00000072451.3
	ENSRNOP00000088313
	ENSRNOP00000088313.1

RefSeq Acc Id:	NP_001108511 ⟸ NM_001115039
- UniProtKB:	B0BNM6 (UniProtKB/TrEMBL), F1LVM4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIQAILVFNNHGKPRLVRFYQRFPEEIQQQIVRETFHLVLKRDDNICNFLEGGSLIGGSDYKLI YRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHMDKVHYILQEVVMGGM VLETNMNEIVAQIEAQNRLEKSEGGLSAAPARAVSAVKNINLPEIPRNINIGDLNIKVPNLSQF V hide sequence

Ensembl Acc Id:

ENSRNOP00000072451 ⟸ ENSRNOT00000082591

Ensembl Acc Id:

ENSRNOP00000062692 ⟸ ENSRNOT00000068084

Ensembl Acc Id:

ENSRNOP00000088313 ⟸ ENSRNOT00000096941

Protein Domains

AP complex mu/sigma subunit

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2K302-F1-model_v2	AlphaFold	A0A0G2K302	1-179	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1586888	AgrOrtholog
BioCyc Gene	G2FUF-58770	BioCyc
Ensembl Genes	ENSRNOG00000043141	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000068084.5	UniProtKB/TrEMBL
	ENSRNOT00000082591.3	UniProtKB/TrEMBL
	ENSRNOT00000096941	ENTREZGENE
	ENSRNOT00000096941.2	UniProtKB/TrEMBL
Gene3D-CATH	3.30.450.60	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7936771	IMAGE-MGC_LOAD
InterPro	AP_complex_ssu	UniProtKB/TrEMBL
	AP_mu_sigma_su	UniProtKB/TrEMBL
	APS3	UniProtKB/TrEMBL
	Clathrin_sm-chain_CS	UniProtKB/TrEMBL
	Longin-like	UniProtKB/TrEMBL
KEGG Report	rno:683402	UniProtKB/TrEMBL
MGC_CLONE	MGC:188578	IMAGE-MGC_LOAD
NCBI Gene	683402	ENTREZGENE
PANTHER	PTHR11753	UniProtKB/TrEMBL
Pfam	Clat_adaptor_s	UniProtKB/TrEMBL
PhenoGen	Ap3s2	PhenoGen
PIRSF	AP_complex_sigma	UniProtKB/TrEMBL
PROSITE	CLAT_ADAPTOR_S	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000043141	RatGTEx
Superfamily-SCOP	Longin_like	UniProtKB/TrEMBL
UniProt	A0A0G2K302_RAT	UniProtKB/TrEMBL
	B0BNM6	ENTREZGENE, UniProtKB/TrEMBL
	F1LVM4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-03	Ap3s2	adaptor related protein complex 3 subunit sigma 2	Ap3s2	adaptor-related protein complex 3, sigma 2 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-09-26	Ap3s2	adaptor-related protein complex 3, sigma 2 subunit	LOC683402	similar to AP-3 complex subunit sigma-2 (Adapter-related protein complex 3 sigma-2 subunit) (Sigma-adaptin 3b) (AP-3 complex sigma-3B subunit) (Sigma-3B-adaptin)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC683402	similar to AP-3 complex subunit sigma-2 (Adapter-related protein complex 3 sigma-2 subunit) (Sigma-adaptin 3b) (AP-3 complex sigma-3B subunit) (Sigma-3B-adaptin)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD