Polr1e (RNA polymerase I subunit E)

Gene: Polr1e (RNA polymerase I subunit E) Rattus norvegicus

Analyze

Symbol:

Polr1e

Name:

RNA polymerase I subunit E

RGD ID:

1565773

Description:

Predicted to enable RNA polymerase I general transcription initiation factor binding activity. Predicted to be involved in RNA polymerase I preinitiation complex assembly and transcription elongation by RNA polymerase I. Predicted to be located in fibrillar center and nucleoplasm. Predicted to be part of RNA polymerase I complex. Orthologous to human POLR1E (RNA polymerase I subunit E); PARTICIPATES IN RNA polymerase I transcription pathway; purine metabolic pathway; pyrimidine metabolic pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

DNA-directed RNA polymerase I subunit RPA49; LOC313245; polymerase (RNA) I associated factor 1; polymerase (RNA) I polypeptide E; polymerase (RNA) I subunit E; Praf1; RGD1565773; similar to RNA polymerase I associated factor (PAF53)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	POLR1E (RNA polymerase I subunit E)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Polr1e (polymerase (RNA) I polypeptide E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Polr1e (RNA polymerase I subunit E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	POLR1E (RNA polymerase I subunit E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	POLR1E (RNA polymerase I subunit E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Polr1e (RNA polymerase I subunit E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	POLR1E (RNA polymerase I subunit E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	POLR1E (RNA polymerase I subunit E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Polr1e (RNA polymerase I subunit E)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Polr1e (polymerase (RNA) I polypeptide E)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	POLR1E (RNA polymerase I subunit E)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	polr1e (RNA polymerase I subunit E)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18600	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	RPA49	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	rpoa-49	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	polr1e	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	64,075,123 - 64,090,900 (+)	NCBI		GRCr8
mRatBN7.2	5	59,279,456 - 59,295,346 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	59,279,460 - 59,295,369 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	61,253,610 - 61,269,312 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	63,073,129 - 63,088,831 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	63,042,368 - 63,058,070 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	60,572,573 - 60,588,097 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	60,572,577 - 60,588,240 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	65,081,629 - 65,097,153 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	61,581,916 - 61,598,266 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	57,848,084 - 57,863,764 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acromesomelic dysplasia, Maroteaux type (ISO)

distal arthrogryposis type 1A (ISO)

frontotemporal dementia and/or amyotrophic lateral sclerosis 6 (ISO)

galactosemia (ISO)

genetic disease (ISO)

primary ciliary dyskinesia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

chromium(6+) (ISO)

clofibric acid (EXP)

coumarin (EXP)

cyclosporin A (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

doxorubicin (ISO)

endosulfan (EXP)

enzyme inhibitor (ISO)

epoxiconazole (ISO)

fenthion (ISO)

flutamide (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

methidathion (ISO)

methotrexate (ISO)

N-ethyl-N-nitrosourea (ISO)

N-nitrosodiethylamine (EXP)

ozone (ISO)

paracetamol (EXP)

paraquat (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

sodium dichromate (EXP)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

trimellitic anhydride (ISO)

Triptolide (ISO)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

nucleolar large rRNA transcription by RNA polymerase I (ISO)

RNA polymerase I preinitiation complex assembly (IBA,ISO)

transcription elongation by RNA polymerase I (IBA)

transcription initiation at RNA polymerase I promoter (ISO)

Cellular Component

fibrillar center (IEA,ISO)

nucleolus (ISO)

nucleoplasm (IEA,ISO)

RNA polymerase I complex (IBA,ISO)

Molecular Function

DNA binding (IEA)

protein binding (ISO)

RNA polymerase I general transcription initiation factor binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

purine metabolic pathway (IEA)

pyrimidine metabolic pathway (IEA)

RNA polymerase I transcription pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	RNA polymerase I activity is regulated at multiple steps in the transcription cycle: recent insights into factors that influence transcription elongation.	Schneider DA Gene. 2012 Feb 10;493(2):176-84. doi: 10.1016/j.gene.2011.08.006. Epub 2011 Aug 26.
6.	Conservation between the RNA polymerase I, II, and III transcription initiation machineries.	Vannini A and Cramer P, Mol Cell. 2012 Feb 24;45(4):439-46. doi: 10.1016/j.molcel.2012.01.023.

Additional References at PubMed

PMID:8641287	PMID:11592397	PMID:12477932	PMID:24207024

Genomics

Comparative Map Data

Polr1e
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	64,075,123 - 64,090,900 (+)	NCBI		GRCr8
mRatBN7.2	5	59,279,456 - 59,295,346 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	59,279,460 - 59,295,369 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	61,253,610 - 61,269,312 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	63,073,129 - 63,088,831 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	63,042,368 - 63,058,070 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	60,572,573 - 60,588,097 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	60,572,577 - 60,588,240 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	65,081,629 - 65,097,153 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	61,581,916 - 61,598,266 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	57,848,084 - 57,863,764 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

POLR1E
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	37,485,948 - 37,503,697 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	37,485,948 - 37,503,697 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	37,485,945 - 37,503,694 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	37,475,945 - 37,493,693 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	37,419,179 - 37,436,922 (+)	NCBI		Celera
Cytogenetic Map	9	p13.2	NCBI
HuRef	9	37,437,994 - 37,455,737 (+)	NCBI		HuRef
CHM1_1	9	37,487,650 - 37,505,393 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	37,509,662 - 37,527,361 (+)	NCBI		T2T-CHM13v2.0

Polr1e
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	45,018,609 - 45,034,279 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	45,018,583 - 45,036,565 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	45,018,609 - 45,034,279 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	45,018,583 - 45,036,565 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	45,031,497 - 45,046,564 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	45,039,725 - 45,054,792 (+)	NCBI		MGSCv36	mm8
Celera	4	45,038,923 - 45,053,990 (+)	NCBI		Celera
Cytogenetic Map	4	B1	NCBI
cM Map	4	23.67	NCBI

Polr1e
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955419	28,967,083 - 28,983,862 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955419	28,970,982 - 28,983,862 (-)	NCBI	ChiLan1.0	ChiLan1.0

POLR1E
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	87,088,953 - 87,106,470 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	87,092,088 - 87,112,412 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	37,331,149 - 37,348,652 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	38,255,067 - 38,272,498 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	38,255,067 - 38,272,498 (+)	Ensembl	panpan1.1		panPan2

POLR1E
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	53,793,324 - 53,808,725 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	53,793,042 - 53,808,724 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	52,383,591 - 52,398,993 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	54,903,067 - 54,918,446 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	54,902,788 - 54,929,766 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	53,401,261 - 53,416,637 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	53,430,505 - 53,445,895 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	54,126,950 - 54,142,325 (+)	NCBI		UU_Cfam_GSD_1.0

Polr1e
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	168,717,909 - 168,736,657 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	5,265,441 - 5,288,417 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	5,265,489 - 5,284,231 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

POLR1E
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	238,197,684 - 238,220,524 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	238,197,659 - 238,219,475 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	266,106,665 - 266,126,203 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

POLR1E
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	43,082,707 - 43,101,416 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	43,083,197 - 43,108,367 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	40,148,685 - 40,169,530 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Polr1e
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624930	1,104,311 - 1,122,077 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624930	1,104,387 - 1,120,580 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Polr1e
137 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	26
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000029704
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
1598868	Mcs12	Mammary carcinoma susceptibility QTL 12		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	58973449	60051321	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	2	8	18	12	14	12			54	15	33	3
Low	1	35	39	29	5	29	8	11	20	20	8	8	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107938	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039109871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089098	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC111080	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000029704 ⟹ ENSRNOP00000029128

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	59,279,460 - 59,295,232 (+)	Ensembl
Rnor_6.0 Ensembl	5	60,572,585 - 60,588,093 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092796

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	60,580,754 - 60,581,884 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092827

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	59,279,470 - 59,295,369 (+)	Ensembl
Rnor_6.0 Ensembl	5	60,572,585 - 60,588,240 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000092958 ⟹ ENSRNOP00000075957

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	59,279,470 - 59,295,369 (+)	Ensembl
Rnor_6.0 Ensembl	5	60,572,577 - 60,588,098 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000093042

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	5	60,573,426 - 60,580,869 (+)	Ensembl

RefSeq Acc Id:

NM_001107938 ⟹ NP_001101408

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	64,075,123 - 64,090,899 (+)	NCBI
mRatBN7.2	5	59,279,456 - 59,295,232 (+)	NCBI
Rnor_6.0	5	60,572,573 - 60,588,097 (+)	NCBI
Rnor_5.0	5	65,081,629 - 65,097,153 (+)	NCBI
RGSC_v3.4	5	61,581,916 - 61,598,266 (+)	RGD
Celera	5	57,848,084 - 57,863,764 (+)	RGD

Sequence:

show sequence

GAGTCCGCGTGTGAACCAGCGAGCTCATGGCTACGCCGGATTCTCCCGGGATGGATGGCCAGAC
TGGAGACACGGAGACAGAGGTGCTACAGAGTGCAAGATGGCAGTACTGTGGAGAGCCCGACGAC
AGGCAGAAAGCTGTGCTGGTCCAATTCTCCAATGGGAAGCTGCAGAATCCAGGCAACATGCGCT
TCACCTTGTACAACAGCACCGACTTGGTAAACCCCAGGCAGAAGTGCCATCGGATCCTGGCCGC
TGAGACAGACAGGCTCTCCTATGTTGGAAACAATTTTGGGACTGGCGCCCTCAAATGCAACACT
CTTTGCAGACACTTTGTGGGCATTCTGAATAAGACCTCTGGCCAAATGGAAGTCTATGATGCGG
AAGTATTCAACATGCAGCCCCTGTTTGCTGAAGACTCTATTGAGCATGGGCCTCCTCTGGAGAA
TCAGAACAAGACCTTCAGGGACAAGTTGGATTCTTGCATTGAAGCCTTTGGAAGCACCAAGCAG
AAGCGGTCCCTGAACTCCCGGAGAATGAACAAAGTTGGCAGCGAGTCTTTGAATTTCACAGTAG
CTAAAGCCGCAGAGAGTATCATTGACACGAAGGGCGTGAGTGCTTTGGTCAGCGATGCCATGCA
AGATGACTTGCAAAATGACTCCCTCTACCTTCCTCCCTGCCATGCTGATGCCACCAAGCCCGAA
GACGTGTATAGATTTGAAGACATCCTGTCCCCGGCCGAGTATGATGCTCTTGAAAGCCCATCCG
AAGCCTTCAGAAAGGTCATGTCTGAAGACATACTGAAGATGGTGGAAGAGAACAGCCACTGCTC
CTTCATCATAGAAATGCTGAAGTCTTTGCCAGCAGACGAGGTGCAGCGAAACCGGCAAGCCCGG
AGCATTTGGTTCCTAGATGCCCTCCTCAGATTCCGAGCTCAGAAAGTGATAAAAGGGAAAAGTG
CCTTAGGACCTGGGATCCCGCACATCATCAACACCAAGCTGCTGAAGCAGTTCACCTGCTTGAC
CTACAACAACGGCAGTTTACGGAACTTAATCTCGAGTTCTATGAAGGCCAAGATCACTGCATAT
GCAATCATCCTTGCTCTGCACATAAATAACTTCCAGATTGATCTGACGGTGTTACAGAGGGACT
TGAAGCTGAGTGAGAAAAGGATGATTGAGATAGCGAGAGCCATGAGGCTGAAGATCTCCAAAAG
AAAGGTGTCCCTGGCAGATGGCAGGGAAGAGGATCATAGACTGGGCACTCTGTCCGTCCCACTG
CCTCCGGCCCAGACCTCAGACCGACAGTCGAAGCGGAAAAAAATGAGCTAGACGTTTTCCACAG
CTACTTCTCTTCACTTCATTCTTACTTTTTTATTTTTTGAAAAAGAAAGTAGACTGGACCTTGT
GGTACATACCTAGAAGCCAAGAACTCAGGAGACTGAGGCAGGAGGATTATGAATTCTGGGCCTG
TCTGGGATGCTGCCACGCTCCACCACACCTGCAAGGCCTTACTTTAGCATGGTTACCATGCCGA
AAGCCAGCATTCCAGTTATCAGAAATTAAAACGATGGCCCTGGTTTGACTTC

hide sequence

RefSeq Acc Id:

XM_039109871 ⟹ XP_038965799

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	64,083,056 - 64,090,900 (+)	NCBI
mRatBN7.2	5	59,287,387 - 59,295,346 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101408	(Get FASTA)	NCBI Sequence Viewer
	XP_038965799	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58700	(Get FASTA)	NCBI Sequence Viewer
	EDL98803	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000029128
	ENSRNOP00000029128.5
	ENSRNOP00000075957
	ENSRNOP00000075957.2
	ENSRNOP00000094559.1

RefSeq Acc Id:

NP_001101408 ⟸ NM_001107938

- UniProtKB:

B0BN64 (UniProtKB/TrEMBL), A0A1B0GWN1 (UniProtKB/TrEMBL), A0A9K3Y7A9 (UniProtKB/TrEMBL), A0A8I6AL91 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MATPDSPGMDGQTGDTETEVLQSARWQYCGEPDDRQKAVLVQFSNGKLQNPGNMRFTLYNSTDL
VNPRQKCHRILAAETDRLSYVGNNFGTGALKCNTLCRHFVGILNKTSGQMEVYDAEVFNMQPLF
AEDSIEHGPPLENQNKTFRDKLDSCIEAFGSTKQKRSLNSRRMNKVGSESLNFTVAKAAESIID
TKGVSALVSDAMQDDLQNDSLYLPPCHADATKPEDVYRFEDILSPAEYDALESPSEAFRKVMSE
DILKMVEENSHCSFIIEMLKSLPADEVQRNRQARSIWFLDALLRFRAQKVIKGKSALGPGIPHI
INTKLLKQFTCLTYNNGSLRNLISSSMKAKITAYAIILALHINNFQIDLTVLQRDLKLSEKRMI
EIARAMRLKISKRKVSLADGREEDHRLGTLSVPLPPAQTSDRQSKRKKMS

hide sequence

RefSeq Acc Id:

ENSRNOP00000075957 ⟸ ENSRNOT00000092958

RefSeq Acc Id:

ENSRNOP00000029128 ⟸ ENSRNOT00000029704

RefSeq Acc Id:	XP_038965799 ⟸ XM_039109871
- Peptide Label:	isoform X1
- UniProtKB:	F7ESP7 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BN64-F1-model_v2	AlphaFold	B0BN64	1-434	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693697

Promoter ID:

EPDNEW_R4220

Type:

multiple initiation site

Name:

Polr1e_1

Description:

RNA polymerase I subunit E

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	60,572,560 - 60,572,620	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1565773	AgrOrtholog
BioCyc Gene	G2FUF-41459	BioCyc
Ensembl Genes	ENSRNOG00000012664	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000029704.7	UniProtKB/TrEMBL
	ENSRNOT00000092827.2	UniProtKB/TrEMBL
	ENSRNOT00000092958	ENTREZGENE
	ENSRNOT00000092958.2	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9028317	IMAGE-MGC_LOAD
InterPro	RNA_pol-assoc_fac_A49-like	UniProtKB/TrEMBL
KEGG Report	rno:313245	UniProtKB/TrEMBL
MGC_CLONE	MGC:187771	IMAGE-MGC_LOAD
NCBI Gene	313245	ENTREZGENE
PANTHER	DNA-DIRECTED RNA POLYMERASE I SUBUNIT RPA49	UniProtKB/TrEMBL
	PTHR14440	UniProtKB/TrEMBL
Pfam	RNA_pol_I_A49	UniProtKB/TrEMBL
PhenoGen	Polr1e	PhenoGen
RatGTEx	ENSRNOG00000012664	RatGTEx
UniProt	A0A1B0GWN1	ENTREZGENE
	A0A8I6AL91	ENTREZGENE, UniProtKB/TrEMBL
	A0A9K3Y7A9	ENTREZGENE, UniProtKB/TrEMBL
	B0BN64	ENTREZGENE, UniProtKB/TrEMBL
	F7ESP7	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A0A1B0GWN1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-07-21	Polr1e	RNA polymerase I subunit E	Polr1e	polymerase (RNA) I subunit E	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-03-09	Polr1e	polymerase (RNA) I subunit E	Polr1e	polymerase (RNA) I polypeptide E	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-06	Polr1e	polymerase (RNA) I polypeptide E	Praf1_predicted	polymerase (RNA) I associated factor 1 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Praf1_predicted	polymerase (RNA) I associated factor 1 (predicted)	RGD1565773_predicted	similar to RNA polymerase I associated factor (PAF53) (predicted)	Symbol and Name updated	1299863	APPROVED
2006-03-07	RGD1565773_predicted	similar to RNA polymerase I associated factor (PAF53) (predicted)	LOC313245	similar to RNA polymerase I associated factor (PAF53)	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC313245	similar to RNA polymerase I associated factor (PAF53)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - KEGG (archival)