Symbol:
Stam
Name:
signal transducing adaptor molecule
RGD ID:
1564499
Description:
Predicted to enable ubiquitin-like protein ligase binding activity. Predicted to be involved in positive regulation of exosomal secretion; protein transport to vacuole involved in ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway; and regulation of extracellular exosome assembly. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Predicted to be part of ESCRT-0 complex. Orthologous to human STAM (signal transducing adaptor molecule); PARTICIPATES IN interleukin-2 signaling pathway; endocytosis pathway; Jak-Stat signaling pathway; INTERACTS WITH acrylamide; bisphenol A; Brodifacoum.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
LOC498798; RGD1564499; signal transducing adapter molecule 1; signal transducing adaptor molecule (SH3 domain and ITAM motif) 1; similar to signal transducing adaptor - mouse
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 82,028,779 - 82,074,717 (+) NCBI GRCr8 mRatBN7.2 17 77,120,235 - 77,166,173 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 77,120,158 - 77,166,467 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 80,570,551 - 80,615,048 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 84,405,965 - 84,450,462 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 78,453,865 - 78,498,362 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 81,209,795 - 81,256,111 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 81,209,867 - 81,255,808 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 82,954,327 - 83,002,657 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 88,276,082 - 88,321,955 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 76,453,145 - 76,499,077 (+) NCBI Celera Cytogenetic Map 17 q12.3 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Imported Annotations - KEGG (archival)
Imported Annotations - PID (archival)
Stam Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 82,028,779 - 82,074,717 (+) NCBI GRCr8 mRatBN7.2 17 77,120,235 - 77,166,173 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 77,120,158 - 77,166,467 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 80,570,551 - 80,615,048 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 84,405,965 - 84,450,462 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 78,453,865 - 78,498,362 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 81,209,795 - 81,256,111 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 81,209,867 - 81,255,808 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 82,954,327 - 83,002,657 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 88,276,082 - 88,321,955 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera 17 76,453,145 - 76,499,077 (+) NCBI Celera Cytogenetic Map 17 q12.3 NCBI
STAM Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 10 17,644,151 - 17,716,824 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 10 17,644,151 - 17,716,824 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 10 17,686,150 - 17,758,823 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 10 17,726,130 - 17,797,913 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 10 17,726,129 - 17,797,913 NCBI Celera 10 17,619,602 - 17,691,384 (+) NCBI Celera Cytogenetic Map 10 p12.33 NCBI HuRef 10 17,598,859 - 17,671,557 (+) NCBI HuRef CHM1_1 10 17,686,508 - 17,759,210 (+) NCBI CHM1_1 T2T-CHM13v2.0 10 17,662,652 - 17,736,129 (+) NCBI T2T-CHM13v2.0
Stam Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 2 14,078,912 - 14,152,351 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 2 14,078,909 - 14,154,445 (+) Ensembl GRCm39 Ensembl GRCm38 2 14,073,962 - 14,148,338 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 2 14,074,098 - 14,149,634 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 2 13,995,739 - 14,069,965 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 2 13,991,866 - 14,066,092 (+) NCBI MGSCv36 mm8 Celera 2 13,978,783 - 14,051,519 (+) NCBI Celera Cytogenetic Map 2 A2 NCBI cM Map 2 10.36 NCBI
Stam Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955429 10,306,957 - 10,366,081 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955429 10,306,957 - 10,366,072 (-) NCBI ChiLan1.0 ChiLan1.0
STAM Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 8 30,485,153 - 30,561,119 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 10 30,492,656 - 30,566,440 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 10 17,962,759 - 18,035,654 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 10 18,232,548 - 18,305,169 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 10 18,232,548 - 18,305,197 (+) Ensembl panpan1.1 panPan2
STAM Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 2 19,264,392 - 19,344,187 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 2 19,266,055 - 19,344,045 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 2 16,365,991 - 16,445,808 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 2 19,553,884 - 19,634,156 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 2 19,553,652 - 19,652,382 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 2 16,756,688 - 16,836,708 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 2 17,592,245 - 17,672,295 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 2 18,212,306 - 18,292,067 (-) NCBI UU_Cfam_GSD_1.0
Stam Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024409344 18,270,841 - 18,333,310 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936520 9,624,628 - 9,689,686 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936520 9,627,674 - 9,689,658 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
STAM Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 10 43,947,011 - 44,016,056 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 10 43,946,990 - 44,016,064 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 10 48,632,911 - 48,699,716 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
STAM Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 9 17,590,252 - 17,662,278 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 9 17,590,268 - 17,663,986 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666051 23,235,162 - 23,320,904 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Stam
.
Predicted Target Of
Count of predictions: 139 Count of miRNA genes: 117 Interacting mature miRNAs: 130 Transcripts: ENSRNOT00000035634 Prediction methods: Miranda, Pita Result types: miRGate_prediction
8694181 Bw151 Body weight QTL 151 4.36 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 1358295 Aocep1 Aortic cell protein QTL 1 6.1 7e-07 thoracic aorta cellular protein amount (VT:0010598) aortic cell percentage 17 40990005 85990005 Rat 12904736 Cm121 Cardiac mass QTL 121 0.043 heart mass (VT:0007028) heart wet weight to body weight ratio (CMO:0002408) 17 71774621 82479847 Rat 152023626 Bp403 Blood pressure QTL 403 3.86 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 7411575 Bw140 Body weight QTL 140 30.2 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 48560935 86533673 Rat 2301412 Kidm40 Kidney mass QTL 40 0.001 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 17 37479847 82479847 Rat 2317060 Aia26 Adjuvant induced arthritis QTL 26 3.22 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 17 38281509 83281509 Rat 631502 Cm26 Cardiac mass QTL 26 3.71 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 65703580 81153923 Rat 1354588 Bvd4 Brain ventricular dilatation QTL 4 5.31 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 17 53498828 82479847 Rat 7411577 Bw141 Body weight QTL 141 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 17 62619516 86533673 Rat 4889894 Eae33 Experimental allergic encephalomyelitis QTL 33 5.2 0.0001 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis severity score (CMO:0001419) 17 50909099 86022412 Rat 2317038 Ginf3 Gastrointestinal inflammation QTL 3 2.89 0.005 liver integrity trait (VT:0010547) liver granuloma severity score (CMO:0002157) 17 49920154 86533673 Rat 1598871 Memor5 Memory QTL 5 5.3 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 17 40540041 80387013 Rat 7488963 Bp369 Blood pressure QTL 369 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 59005649 77910000 Rat 1300129 Rf25 Renal function QTL 25 3.03 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 17 71003325 81153923 Rat 152023740 Bp406 Blood pressure QTL 406 6.06 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 1354663 Bvd5 Brain ventricular dilatation QTL 5 3.51 0.001 brain ventricle morphology trait (VT:0000822) hydrocephalus severity score (CMO:0001881) 17 31990784 81292925 Rat 152023737 Bp405 Blood pressure QTL 405 5.06 arterial blood pressure trait (VT:2000000) 23930421 79524188 Rat 2317045 Aia11 Adjuvant induced arthritis QTL 11 4.06 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 60781426 86533673 Rat 152023736 Bp404 Blood pressure QTL 404 3.78 arterial blood pressure trait (VT:2000000) 17 23930421 79524188 Rat 152025238 Slep14 Serum leptin concentration QTL 14 4.62 blood leptin amount (VT:0005667) 17 24184890 79524188 Rat 2317054 Aia12 Adjuvant induced arthritis QTL 12 4.24 joint integrity trait (VT:0010548) left rear ankle joint diameter (CMO:0002149) 17 38281509 83281509 Rat 2302365 Gluco40 Glucose level QTL 40 4.79 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 17 57246843 82046127 Rat 2303580 Gluco49 Glucose level QTL 49 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 17 50040271 86533673 Rat
AU049126
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 77,127,042 - 77,127,213 (+) MAPPER mRatBN7.2 Rnor_6.0 17 81,216,675 - 81,216,845 NCBI Rnor6.0 Rnor_5.0 17 82,961,135 - 82,961,305 UniSTS Rnor5.0 RGSC_v3.4 17 88,282,890 - 88,283,060 UniSTS RGSC3.4 Celera 17 76,459,955 - 76,460,125 UniSTS Cytogenetic Map 17 q12.3 UniSTS
BF386478
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 77,166,242 - 77,166,400 (+) MAPPER mRatBN7.2 Rnor_6.0 17 81,255,878 - 81,256,035 NCBI Rnor6.0 Rnor_5.0 17 83,002,424 - 83,002,581 UniSTS Rnor5.0 RGSC_v3.4 17 88,322,025 - 88,322,182 UniSTS RGSC3.4 Celera 17 76,499,147 - 76,499,304 UniSTS RH 3.4 Map 17 795.6 UniSTS Cytogenetic Map 17 q12.3 UniSTS
BE109742
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 77,165,643 - 77,165,797 (+) MAPPER mRatBN7.2 Rnor_6.0 17 81,255,279 - 81,255,432 NCBI Rnor6.0 Rnor_5.0 17 83,001,825 - 83,001,978 UniSTS Rnor5.0 RGSC_v3.4 17 88,321,426 - 88,321,579 UniSTS RGSC3.4 Celera 17 76,498,548 - 76,498,701 UniSTS RH 3.4 Map 9 868.5 UniSTS Cytogenetic Map 17 q12.3 UniSTS
RH141478
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 77,165,740 - 77,165,890 (+) MAPPER mRatBN7.2 Rnor_6.0 17 81,255,376 - 81,255,525 NCBI Rnor6.0 Rnor_5.0 17 83,001,922 - 83,002,071 UniSTS Rnor5.0 RGSC_v3.4 17 88,321,523 - 88,321,672 UniSTS RGSC3.4 Celera 17 76,498,645 - 76,498,794 UniSTS RH 3.4 Map 17 771.2 UniSTS Cytogenetic Map 17 q12.3 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000077368 ⟹ ENSRNOP00000075157
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 77,120,158 - 77,166,467 (+) Ensembl Rnor_6.0 Ensembl 17 81,209,867 - 81,255,808 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000087129 ⟹ ENSRNOP00000068837
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 77,132,843 - 77,166,467 (+) Ensembl Rnor_6.0 Ensembl 17 81,209,985 - 81,254,571 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000119151 ⟹ ENSRNOP00000085119
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 77,120,506 - 77,166,467 (+) Ensembl
RefSeq Acc Id:
NM_001109121 ⟹ NP_001102591
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 82,028,779 - 82,074,717 (+) NCBI mRatBN7.2 17 77,120,235 - 77,166,173 (+) NCBI Rnor_6.0 17 81,209,867 - 81,255,808 (+) NCBI Rnor_5.0 17 82,954,327 - 83,002,657 (+) NCBI RGSC_v3.4 17 88,276,082 - 88,321,955 (+) RGD Celera 17 76,453,145 - 76,499,077 (+) RGD
Sequence:
CCTGCACTGGCAATCTCCCTTAGTGTTTTTGTACCTGAGGGGCCTCCTTTCTCCGTCACTTCTCGAGTGCCGCGGTGTCGAGGGGCAGTCCCTGGGGACACCTCGGCACGCAGCGGACATGCCTCTCT
hide sequence
RefSeq Acc Id:
XM_017600651 ⟹ XP_017456140
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 82,028,949 - 82,074,717 (+) NCBI mRatBN7.2 17 77,120,510 - 77,166,173 (+) NCBI Rnor_6.0 17 81,210,037 - 81,256,111 (+) NCBI
Sequence:
ACCGCCCCCTGTGAGTGCCCTCAACCCCCGAGACCACGAGCCCACGCCGCCCACTCTCTCCCTGCGTTCGTTCATTCTAAATTCCCAAGGCCGAGCCCACGTTCTTCTCTCCCGGGGCCCCTTGGTTC
hide sequence
RefSeq Acc Id:
NP_001102591 ⟸ NM_001109121
- UniProtKB:
B5DF55 (UniProtKB/TrEMBL), A0A0G2K9W6 (UniProtKB/TrEMBL), A0A0G2JTT5 (UniProtKB/TrEMBL)
- Sequence:
MPLFATNPFDQDVEKATSELNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLI
hide sequence
RefSeq Acc Id:
XP_017456140 ⟸ XM_017600651
- Peptide Label:
isoform X1
- UniProtKB:
A0A8I6A2K6 (UniProtKB/TrEMBL), A0A0G2JTT5 (UniProtKB/TrEMBL)
- Sequence:
MRRVNHKDPHVAMQALTLLGACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVE
hide sequence
Ensembl Acc Id:
ENSRNOP00000075157 ⟸ ENSRNOT00000077368
Ensembl Acc Id:
ENSRNOP00000068837 ⟸ ENSRNOT00000087129
Ensembl Acc Id:
ENSRNOP00000085119 ⟸ ENSRNOT00000119151
RGD ID: 13700598 Promoter ID: EPDNEW_R11121 Type: initiation region Name: Stam_1 Description: signal transducing adaptor molecule SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 81,209,792 - 81,209,852 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2015-11-25
Stam
signal transducing adaptor molecule
Stam
signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-03-06
Stam
signal transducing adaptor molecule (SH3 domain and ITAM motif) 1
RGD1564499_predicted
similar to signal transducing adaptor - mouse (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-07
RGD1564499_predicted
similar to signal transducing adaptor - mouse (predicted)
LOC498798
similar to signal transducing adaptor - mouse
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC498798
similar to signal transducing adaptor - mouse
Symbol and Name status set to provisional
70820 PROVISIONAL
