Symbol:
Hs6st2
Name:
heparan sulfate 6-O-sulfotransferase 2
RGD ID:
1564397
Description:
Predicted to enable heparan sulfate 6-sulfotransferase activity. Predicted to be involved in heparan sulfate proteoglycan biosynthetic process, enzymatic modification. Predicted to be located in membrane. Predicted to be active in Golgi apparatus. Human ortholog(s) of this gene implicated in Paganini-Miozzo syndrome. Orthologous to human HS6ST2 (heparan sulfate 6-O-sulfotransferase 2); PARTICIPATES IN heparan sulfate biosynthetic pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-Tetrachlorodibenzofuran; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
heparan-sulfate 6-O-sulfotransferase 2; LOC302489; RGD1563872; RGD1564397; similar to heparan sulfate 6-O-sulfotransferase 2 isoform S
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 135,887,224 - 136,182,388 (-) NCBI GRCr8 mRatBN7.2 X 130,966,547 - 131,261,629 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 130,968,385 - 131,261,492 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 133,124,918 - 133,418,748 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 136,706,854 - 137,000,684 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 134,281,915 - 134,575,023 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 138,675,326 - 138,972,774 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 138,677,580 - 138,972,684 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 138,733,912 - 139,028,075 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 138,268,438 - 138,566,049 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 129,889,782 - 130,179,847 (-) NCBI Celera Cytogenetic Map X q36 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Hs6st2 Rat 1,1-dichloroethene decreases expression ISO Hs6st2 (Mus musculus) 6480464 vinylidene chloride results in decreased expression of HS6ST2 mRNA CTD PMID:26682919 Hs6st2 Rat 17alpha-ethynylestradiol increases expression EXP 6480464 Ethinyl Estradiol results in increased expression of HS6ST2 mRNA CTD PMID:29097150 Hs6st2 Rat 17beta-estradiol multiple interactions ISO HS6ST2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of HS6ST2 mRNA and [Estradiol co-treated with TGFB1 protein] results in decreased expression of HS6ST2 mRNA CTD PMID:20660070 and PMID:30165855 Hs6st2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Hs6st2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of HS6ST2 mRNA CTD PMID:15034205 Hs6st2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Hs6st2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether increases expression ISO HS6ST2 (Homo sapiens) 6480464 2 more ... CTD PMID:26705709 Hs6st2 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Hs6st2 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Hs6st2 Rat 2-methylcholine affects expression ISO HS6ST2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of HS6ST2 mRNA CTD PMID:21179406 Hs6st2 Rat 5-fluorouracil decreases expression ISO HS6ST2 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of HS6ST2 mRNA CTD PMID:16510598 Hs6st2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of HS6ST2 mRNA CTD PMID:24780913 Hs6st2 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of HS6ST2 mRNA CTD PMID:28959563 Hs6st2 Rat aldehydo-D-glucose multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of HS6ST2 mRNA CTD PMID:37567420 Hs6st2 Rat all-trans-retinoic acid decreases expression ISO HS6ST2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of HS6ST2 mRNA CTD PMID:23724009 and PMID:33167477 Hs6st2 Rat antirheumatic drug increases expression ISO HS6ST2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of HS6ST2 mRNA CTD PMID:24449571 Hs6st2 Rat aristolochic acid A decreases expression ISO HS6ST2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of HS6ST2 mRNA CTD PMID:33212167 Hs6st2 Rat arsenite(3-) multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of HS6ST2 mRNA CTD PMID:15894712 Hs6st2 Rat arsenite(3-) increases methylation ISO HS6ST2 (Homo sapiens) 6480464 arsenite results in increased methylation of HS6ST2 promoter CTD PMID:23974009 Hs6st2 Rat arsenite(3-) decreases expression ISO Hs6st2 (Mus musculus) 6480464 arsenite results in decreased expression of HS6ST2 mRNA CTD PMID:15894712 Hs6st2 Rat benzo[a]pyrene multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of HS6ST2 mRNA CTD PMID:15894712 Hs6st2 Rat benzo[a]pyrene affects methylation ISO HS6ST2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of HS6ST2 5' UTR and Benzo(a)pyrene affects the methylation of HS6ST2 promoter CTD PMID:27901495 Hs6st2 Rat benzo[a]pyrene decreases expression ISO Hs6st2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of HS6ST2 mRNA CTD PMID:15034205 and PMID:15894712 Hs6st2 Rat benzo[a]pyrene affects expression ISO HS6ST2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the expression of HS6ST2 mRNA CTD PMID:22316170 Hs6st2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO HS6ST2 (Homo sapiens) 6480464 7 more ... CTD PMID:19150397 Hs6st2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Hs6st2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of HS6ST2 mRNA CTD PMID:33754040 Hs6st2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of HS6ST2 mRNA CTD PMID:25181051 Hs6st2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of HS6ST2 mRNA CTD PMID:30816183 more ... Hs6st2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of HS6ST2 gene CTD PMID:28505145 Hs6st2 Rat bisphenol F increases expression ISO Hs6st2 (Mus musculus) 6480464 bisphenol F results in increased expression of HS6ST2 mRNA CTD PMID:30951980 Hs6st2 Rat cadmium atom multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of HS6ST2 mRNA CTD PMID:31904401 Hs6st2 Rat cadmium dichloride multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of HS6ST2 mRNA CTD PMID:31904401 Hs6st2 Rat calcitriol increases expression ISO HS6ST2 (Homo sapiens) 6480464 Calcitriol results in increased expression of HS6ST2 mRNA CTD PMID:16002434 Hs6st2 Rat carbon nanotube decreases expression ISO Hs6st2 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of HS6ST2 mRNA CTD PMID:25554681 Hs6st2 Rat CGP 52608 multiple interactions ISO HS6ST2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to HS6ST2 gene] CTD PMID:28238834 Hs6st2 Rat choline multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of HS6ST2 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of HS6ST2 gene CTD PMID:20938992 Hs6st2 Rat copper atom increases expression EXP 6480464 Copper deficiency results in increased expression of HS6ST2 mRNA CTD PMID:26033743 Hs6st2 Rat copper atom multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of HS6ST2 mRNA CTD PMID:15467011 Hs6st2 Rat copper(0) increases expression EXP 6480464 Copper deficiency results in increased expression of HS6ST2 mRNA CTD PMID:26033743 Hs6st2 Rat copper(0) multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in increased expression of HS6ST2 mRNA CTD PMID:15467011 Hs6st2 Rat coumestrol multiple interactions ISO HS6ST2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of HS6ST2 mRNA CTD PMID:19167446 Hs6st2 Rat D-glucose multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of HS6ST2 mRNA CTD PMID:37567420 Hs6st2 Rat DDE increases expression ISO HS6ST2 (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in increased expression of HS6ST2 mRNA CTD PMID:38568856 Hs6st2 Rat diclofenac increases expression ISO Hs6st2 (Mus musculus) 6480464 Diclofenac results in increased expression of HS6ST2 mRNA CTD PMID:26934552 Hs6st2 Rat diquat decreases expression ISO Hs6st2 (Mus musculus) 6480464 Diquat results in decreased expression of HS6ST2 mRNA CTD PMID:36851058 Hs6st2 Rat dorsomorphin multiple interactions ISO HS6ST2 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HS6ST2 mRNA CTD PMID:27188386 Hs6st2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of HS6ST2 mRNA CTD PMID:29391264 Hs6st2 Rat Enterolactone multiple interactions ISO HS6ST2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of HS6ST2 mRNA CTD PMID:19167446 Hs6st2 Rat entinostat increases expression ISO HS6ST2 (Homo sapiens) 6480464 entinostat results in increased expression of HS6ST2 mRNA CTD PMID:27188386 Hs6st2 Rat ethanol affects splicing ISO Hs6st2 (Mus musculus) 6480464 Ethanol affects the splicing of HS6ST2 mRNA CTD PMID:30319688 Hs6st2 Rat folic acid multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of HS6ST2 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of HS6ST2 gene CTD PMID:20938992 Hs6st2 Rat fructose multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of HS6ST2 mRNA CTD PMID:37567420 Hs6st2 Rat glucose multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in decreased expression of HS6ST2 mRNA CTD PMID:37567420 Hs6st2 Rat glycidol increases expression EXP 6480464 glycidol results in increased expression of HS6ST2 mRNA CTD PMID:24915197 Hs6st2 Rat L-methionine multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of HS6ST2 mRNA and [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of HS6ST2 gene CTD PMID:20938992 Hs6st2 Rat lead(0) affects expression ISO HS6ST2 (Homo sapiens) 6480464 Lead affects the expression of HS6ST2 mRNA CTD PMID:28903495 Hs6st2 Rat leflunomide decreases expression ISO Hs6st2 (Mus musculus) 6480464 leflunomide results in decreased expression of HS6ST2 mRNA CTD PMID:19751817 Hs6st2 Rat methotrexate increases expression ISO HS6ST2 (Homo sapiens) 6480464 Methotrexate results in increased expression of HS6ST2 mRNA CTD PMID:24449571 Hs6st2 Rat methylmercury chloride increases expression ISO HS6ST2 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of HS6ST2 mRNA CTD PMID:26272509 Hs6st2 Rat methylmercury chloride multiple interactions ISO HS6ST2 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HS6ST2 mRNA CTD PMID:27188386 Hs6st2 Rat methylmercury chloride decreases expression ISO HS6ST2 (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of HS6ST2 mRNA CTD PMID:27188386 and PMID:28001369 Hs6st2 Rat morphine increases expression ISO Hs6st2 (Mus musculus) 6480464 Morphine results in increased expression of HS6ST2 mRNA CTD PMID:21178816 Hs6st2 Rat perfluorohexanesulfonic acid increases expression ISO Hs6st2 (Mus musculus) 6480464 perfluorohexanesulfonic acid results in increased expression of HS6ST2 mRNA CTD PMID:37995155 Hs6st2 Rat phorbol 13-acetate 12-myristate multiple interactions ISO Hs6st2 (Mus musculus) 6480464 [Tetradecanoylphorbol Acetate co-treated with [Cadmium Chloride results in increased abundance of Cadmium]] affects the expression of HS6ST2 mRNA CTD PMID:31904401 Hs6st2 Rat progesterone multiple interactions ISO HS6ST2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of HS6ST2 mRNA CTD PMID:20660070 Hs6st2 Rat propanal increases expression ISO HS6ST2 (Homo sapiens) 6480464 propionaldehyde results in increased expression of HS6ST2 mRNA CTD PMID:26079696 Hs6st2 Rat SB 431542 multiple interactions ISO HS6ST2 (Homo sapiens) 6480464 [NOG protein co-treated with methylmercuric chloride co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of HS6ST2 mRNA CTD PMID:27188386 Hs6st2 Rat silicon dioxide increases expression ISO HS6ST2 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of HS6ST2 mRNA CTD PMID:23806026 Hs6st2 Rat sodium arsenite decreases expression ISO HS6ST2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of HS6ST2 mRNA CTD PMID:38568856 Hs6st2 Rat temozolomide increases expression ISO HS6ST2 (Homo sapiens) 6480464 Temozolomide results in increased expression of HS6ST2 mRNA CTD PMID:31758290 Hs6st2 Rat tetrachloromethane affects expression ISO Hs6st2 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of HS6ST2 mRNA CTD PMID:17484886 Hs6st2 Rat thiram decreases expression ISO HS6ST2 (Homo sapiens) 6480464 Thiram results in decreased expression of HS6ST2 mRNA CTD PMID:38568856 Hs6st2 Rat titanium dioxide increases expression ISO Hs6st2 (Mus musculus) 6480464 titanium dioxide results in increased expression of HS6ST2 mRNA CTD PMID:23557971 Hs6st2 Rat titanium dioxide decreases methylation ISO Hs6st2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of HS6ST2 promoter CTD PMID:35295148 Hs6st2 Rat titanium dioxide increases methylation ISO Hs6st2 (Mus musculus) 6480464 titanium dioxide results in increased methylation of HS6ST2 promoter CTD PMID:35295148 Hs6st2 Rat trichostatin A increases expression ISO HS6ST2 (Homo sapiens) 6480464 trichostatin A results in increased expression of HS6ST2 mRNA CTD PMID:24935251 and PMID:27188386 Hs6st2 Rat valproic acid increases methylation ISO HS6ST2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of HS6ST2 gene CTD PMID:29154799 Hs6st2 Rat valproic acid affects expression ISO Hs6st2 (Mus musculus) 6480464 Valproic Acid affects the expression of HS6ST2 mRNA CTD PMID:17963808 Hs6st2 Rat valproic acid affects expression ISO HS6ST2 (Homo sapiens) 6480464 Valproic Acid affects the expression of HS6ST2 mRNA CTD PMID:25979313 Hs6st2 Rat valproic acid increases expression ISO HS6ST2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of HS6ST2 mRNA CTD PMID:23179753 more ... Hs6st2 Rat vorinostat increases expression ISO HS6ST2 (Homo sapiens) 6480464 vorinostat results in increased expression of HS6ST2 mRNA CTD PMID:27188386
Imported Annotations - KEGG (archival)
1,1-dichloroethene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2-methylcholine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acrylamide (EXP) aldehydo-D-glucose (ISO) all-trans-retinoic acid (ISO) antirheumatic drug (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP) bisphenol F (ISO) cadmium atom (ISO) cadmium dichloride (ISO) calcitriol (ISO) carbon nanotube (ISO) CGP 52608 (ISO) choline (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) coumestrol (ISO) D-glucose (ISO) DDE (ISO) diclofenac (ISO) diquat (ISO) dorsomorphin (ISO) endosulfan (EXP) Enterolactone (ISO) entinostat (ISO) ethanol (ISO) folic acid (ISO) fructose (ISO) glucose (ISO) glycidol (EXP) L-methionine (ISO) lead(0) (ISO) leflunomide (ISO) methotrexate (ISO) methylmercury chloride (ISO) morphine (ISO) perfluorohexanesulfonic acid (ISO) phorbol 13-acetate 12-myristate (ISO) progesterone (ISO) propanal (ISO) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) temozolomide (ISO) tetrachloromethane (ISO) thiram (ISO) titanium dioxide (ISO) trichostatin A (ISO) valproic acid (ISO) vorinostat (ISO)
Hs6st2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 135,887,224 - 136,182,388 (-) NCBI GRCr8 mRatBN7.2 X 130,966,547 - 131,261,629 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl X 130,968,385 - 131,261,492 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx X 133,124,918 - 133,418,748 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 136,706,854 - 137,000,684 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 134,281,915 - 134,575,023 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 138,675,326 - 138,972,774 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 138,677,580 - 138,972,684 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 X 138,733,912 - 139,028,075 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 X 138,268,438 - 138,566,049 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 Celera X 129,889,782 - 130,179,847 (-) NCBI Celera Cytogenetic Map X q36 NCBI
HS6ST2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 132,626,015 - 132,961,370 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 132,626,015 - 132,961,395 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 131,760,043 - 132,095,398 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 131,587,719 - 131,923,093 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Celera X 132,146,408 - 132,481,789 (-) NCBI Celera Cytogenetic Map X q26.2 NCBI HuRef X 121,164,083 - 121,496,636 (-) NCBI HuRef CHM1_1 X 131,671,551 - 132,006,998 (-) NCBI CHM1_1 T2T-CHM13v2.0 X 130,950,680 - 131,286,084 (-) NCBI T2T-CHM13v2.0
Hs6st2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 50,476,084 - 50,770,643 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 50,476,089 - 50,770,733 (-) Ensembl GRCm39 Ensembl GRCm38 X 51,386,637 - 51,681,705 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 51,387,212 - 51,681,856 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 48,740,389 - 49,034,779 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 X 47,631,840 - 47,925,107 (-) NCBI MGSCv36 mm8 Celera X 38,808,280 - 39,103,506 (-) NCBI Celera Cytogenetic Map X A5 NCBI cM Map X 28.04 NCBI
Hs6st2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955473 2,002,725 - 2,289,662 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955473 2,002,475 - 2,291,868 (+) NCBI ChiLan1.0 ChiLan1.0
HS6ST2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 132,050,917 - 132,368,649 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 132,054,511 - 132,372,243 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 121,757,028 - 122,090,371 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 132,063,409 - 132,396,038 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 132,065,614 - 132,395,772 (-) Ensembl panpan1.1 panPan2
HS6ST2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 103,529,705 - 103,816,049 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 103,531,378 - 103,815,538 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 89,701,832 - 89,987,973 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 105,389,057 - 105,672,488 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 105,389,174 - 105,672,467 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 102,799,821 - 103,086,005 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 104,675,560 - 104,961,216 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 104,447,839 - 104,734,667 (-) NCBI UU_Cfam_GSD_1.0
Hs6st2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 X 101,700,046 - 101,981,296 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936691 1,976,449 - 2,255,144 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936691 1,976,449 - 2,257,303 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
HS6ST2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 108,757,821 - 109,044,056 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 108,755,577 - 109,043,976 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 124,748,947 - 124,840,520 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
HS6ST2
Hs6st2
.
Predicted Target Of
Count of predictions: 98 Count of miRNA genes: 79 Interacting mature miRNAs: 88 Transcripts: ENSRNOT00000040165 Prediction methods: Microtar, Miranda, Pita, Rnahybrid, Targetscan Result types: miRGate_prediction
1598872 Memor14 Memory QTL 14 4.5 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 93956491 138956491 Rat 1598856 Memor1 Memory QTL 1 1.9 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) X 103312877 148312877 Rat 1598809 Memor15 Memory QTL 15 4.4 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 103312877 148312877 Rat 738025 Stresp3 Stress response QTL 3 4.61 0.0066 stress-related behavior trait (VT:0010451) defensive burying - approach X 100567703 150256146 Rat 634346 Insul4 Insulin level QTL 4 0 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) X 126975089 152453651 Rat 738029 Stresp2 Stress response QTL 2 3.4 0.0004 stress-related behavior trait (VT:0010451) defensive burying - approach X 112934952 138400867 Rat 10059603 Bw174 Body weight QTL 174 3.4 0.025 body mass (VT:0001259) body weight (CMO:0000012) X 113937816 152453651 Rat 1598837 Memor13 Memory QTL 13 3.2 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) X 41052407 146860749 Rat
DXGot103
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 131,228,069 - 131,228,281 (+) MAPPER mRatBN7.2 Rnor_6.0 X 138,939,137 - 138,939,348 NCBI Rnor6.0 Rnor_5.0 X 138,994,443 - 138,994,654 UniSTS Rnor5.0 RGSC_v3.4 X 138,532,734 - 138,532,945 UniSTS RGSC3.4 Celera X 130,146,279 - 130,146,490 UniSTS Cytogenetic Map X q36 UniSTS
RH139153
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 131,018,631 - 131,018,817 (+) MAPPER mRatBN7.2 Rnor_6.0 X 138,727,600 - 138,727,785 NCBI Rnor6.0 Rnor_5.0 X 138,786,186 - 138,786,371 UniSTS Rnor5.0 RGSC_v3.4 X 138,318,682 - 138,318,867 UniSTS RGSC3.4 Celera X 129,940,020 - 129,940,205 UniSTS Cytogenetic Map X q36 UniSTS
Hs6st2
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 X 130,968,960 - 130,969,181 (+) MAPPER mRatBN7.2 Rnor_6.0 X 138,677,745 - 138,677,965 NCBI Rnor6.0 Rnor_5.0 X 138,736,331 - 138,736,551 UniSTS Rnor5.0 Celera X 129,890,358 - 129,890,578 UniSTS Cytogenetic Map X q36 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
8
11
48
112
90
90
59
25
59
6
215
95
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000040165 ⟹ ENSRNOP00000043184
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl X 130,968,385 - 131,261,492 (-) Ensembl Rnor_6.0 Ensembl X 138,677,580 - 138,972,684 (-) Ensembl
RefSeq Acc Id:
NM_001191726 ⟹ NP_001178655
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 135,889,062 - 136,182,154 (-) NCBI mRatBN7.2 X 130,968,385 - 131,261,492 (-) NCBI Rnor_6.0 X 138,677,169 - 138,972,684 (-) NCBI Rnor_5.0 X 138,733,912 - 139,028,075 (-) NCBI Celera X 129,889,782 - 130,179,847 (-) NCBI
Sequence:
ATGGCACTGCCTGCATTTGCAGCCCGGGCGCTTGGGCCGCCACTGCAACCGGAGCAAGGAGCGCCCGCCCGCACCACCTGTCCCCGCCGGCATTCCAGAGTAGAGGCCGAATTGGCAGCAAGCCGGCC
hide sequence
RefSeq Acc Id:
XM_006257578 ⟹ XP_006257640
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 135,887,224 - 136,182,263 (-) NCBI mRatBN7.2 X 130,966,547 - 131,261,614 (-) NCBI Rnor_6.0 X 138,675,326 - 138,972,774 (-) NCBI Rnor_5.0 X 138,733,912 - 139,028,075 (-) NCBI
Sequence:
AAGTGGCTGGGGCTCTTGGGCGCGAGGCATTATTATATAAATTCAAGCTCGCTCCTGATCCTTAGTACCCTGAGTTGCCTGAAGGGGGGAATGGCACTGCCTGCATTTGCAGCCCGGGCGCTTGGGCC
hide sequence
RefSeq Acc Id:
XM_017601970 ⟹ XP_017457459
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 135,887,224 - 136,182,388 (-) NCBI mRatBN7.2 X 130,966,547 - 131,261,629 (-) NCBI Rnor_6.0 X 138,675,326 - 138,972,774 (-) NCBI
Sequence:
AAGTGGCTGGGGCTCTTGGGCGCGAGGCATTATTATATAAATTCAAGCTCGCTCCTGATCCTTAGTACCCTGAGTTGCCTGAAGGGGGGAATGGCACTGCCTGCATTTGCAGCCCGGGCGCTTGGGCC
hide sequence
RefSeq Acc Id:
XM_017601971 ⟹ XP_017457460
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 135,887,224 - 136,182,281 (-) NCBI mRatBN7.2 X 130,966,547 - 131,261,626 (-) NCBI Rnor_6.0 X 138,675,326 - 138,972,774 (-) NCBI
Sequence:
AAGTGGCTGGGGCTCTTGGGCGCGAGGCATTATTATATAAATTCAAGCTCGCTCCTGATCCTTAGTACCCTGAGTTGCCTGAAGGGGGGAATGGCACTGCCTGCATTTGCAGCCCGGGCGCTTGGGCC
hide sequence
RefSeq Acc Id:
XM_017601972 ⟹ XP_017457461
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 135,887,224 - 136,181,475 (-) NCBI mRatBN7.2 X 130,966,547 - 131,260,833 (-) NCBI Rnor_6.0 X 138,675,326 - 138,972,068 (-) NCBI
Sequence:
CGCGGGAAAGGGCTGCGCTGCCTCTGCTTGCAAAGTCAGGCAGCCCGCGGGCTCCTTCCTTCTC
hide sequence
RefSeq Acc Id:
XM_017601973 ⟹ XP_017457462
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 135,887,224 - 136,181,123 (-) NCBI mRatBN7.2 X 130,966,547 - 131,260,471 (-) NCBI Rnor_6.0 X 138,675,326 - 138,971,657 (-) NCBI
Sequence:
GCAGAAGCCACAGCGCTGAGCCTGCCGGGAAGGAAGGAAGCGGGGAAGGGCGCCGCTGCCGCCG
hide sequence
RefSeq Acc Id:
XM_063279904 ⟹ XP_063135974
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 135,887,224 - 136,181,407 (-) NCBI
RefSeq Acc Id:
XM_063279905 ⟹ XP_063135975
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 135,887,224 - 136,181,123 (-) NCBI
RefSeq Acc Id:
NP_001178655 ⟸ NM_001191726
- UniProtKB:
D3ZEK5 (UniProtKB/TrEMBL), A6JMT6 (UniProtKB/TrEMBL)
- Sequence:
MALPAFAARALGPPLQPEQGAPARTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSLGFNSPPLQDKPPKTFSSLAGALRAPLFALLPRGRRRRMHDLRRRWDLGSLCRALLTRGLAAVGHSLKH
hide sequence
RefSeq Acc Id:
XP_006257640 ⟸ XM_006257578
- Peptide Label:
isoform X3
- UniProtKB:
A6JMT5 (UniProtKB/TrEMBL)
- Sequence:
MALPAFAARALGPPLQPEQGAPARTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSLGFNS
hide sequence
RefSeq Acc Id:
XP_017457459 ⟸ XM_017601970
- Peptide Label:
isoform X1
- UniProtKB:
A6JMT6 (UniProtKB/TrEMBL)
- Sequence:
MALPAFAARALGPPLQPEQGAPARTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSLGFNS
hide sequence
RefSeq Acc Id:
XP_017457460 ⟸ XM_017601971
- Peptide Label:
isoform X2
- UniProtKB:
A6JMT5 (UniProtKB/TrEMBL)
- Sequence:
MALPAFAARALGPPLQPEQGAPARTTCPRRHSRVEAELAASRPGSVAASVRAGPPRGVSLGFNSPPLQDKPPKTFSSLAGALRAPLFALLPRGRRRRMHDLRRRWDLGSLCRALLTRGLAAVGHSLKH
hide sequence
RefSeq Acc Id:
XP_017457461 ⟸ XM_017601972
- Peptide Label:
isoform X4
- UniProtKB:
A6JMT6 (UniProtKB/TrEMBL)
- Sequence:
MGIGAGERRAGSTQSPRRVAVGNMDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESSARFVPRYNFSRGDLLRKVDFDIKGDDLIVFLHIQKTGGTTFGRHLVRNIQ
hide sequence
RefSeq Acc Id:
XP_017457462 ⟸ XM_017601973
- Peptide Label:
isoform X5
- UniProtKB:
A6JMT6 (UniProtKB/TrEMBL)
- Sequence:
MDEKSNKLLLALVMLFLFAVIVLQYVCPGTECQLLRLQAFSSPVPDPYRSEDESSARFVPRYNF
hide sequence
Ensembl Acc Id:
ENSRNOP00000043184 ⟸ ENSRNOT00000040165
RefSeq Acc Id:
XP_063135974 ⟸ XM_063279904
- Peptide Label:
isoform X6
- UniProtKB:
A6JMT5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063135975 ⟸ XM_063279905
- Peptide Label:
isoform X7
- UniProtKB:
A6JMT5 (UniProtKB/TrEMBL)
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Hs6st2
heparan sulfate 6-O-sulfotransferase 2
RGD1564397_predicted
similar to heparan sulfate 6-O-sulfotransferase 2 isoform S (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-01-09
RGD1564397_predicted
similar to heparan sulfate 6-O-sulfotransferase 2 isoform S (predicted)
LOC683774
similar to Heparan-sulfate 6-O-sulfotransferase 2 (HS6ST-2)
Data merged from RGD:1583321
1643240 APPROVED
2006-11-19
LOC683774
similar to Heparan-sulfate 6-O-sulfotransferase 2 (HS6ST-2)
Symbol and Name status set to provisional
70820 PROVISIONAL
2006-03-07
RGD1564397_predicted
similar to heparan sulfate 6-O-sulfotransferase 2 isoform S (predicted)
LOC302489
similar to heparan sulfate 6-O-sulfotransferase 2 isoform S
Symbol and Name status set to approved
1299863 APPROVED
2006-02-09
LOC302489
similar to heparan sulfate 6-O-sulfotransferase 2 isoform S
Symbol and Name status set to provisional
70820 PROVISIONAL
