Advanced Search (OLGA)

Gene: Inka1 (inka box actin regulator 1) Rattus norvegicus

Analyze

Symbol:

Inka1

Name:

inka box actin regulator 1

RGD ID:

1560778

Description:

Predicted to enable protein kinase binding activity and protein serine/threonine kinase inhibitor activity. Predicted to act upstream of or within neural tube development. Predicted to be located in cytoplasm. Predicted to be active in nucleus. Orthologous to human INKA1 (inka box actin regulator 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acrylamide; all-trans-retinoic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Fam212a; family with sequence similarity 212, member A; hypothetical protein LOC316001; INKA1 protein; LOC316001; PAK4-inhibitor INKA1; RGD1560778; similar to RIKEN cDNA 6530418L21

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	INKA1 (inka box actin regulator 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Inka1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Inka1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	INKA1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	INKA1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Inka1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	INKA1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	INKA1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Inka1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Inka1 (inka box actin regulator 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KANK1 (KN motif and ankyrin repeat domains 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	INKA1 (inka box actin regulator 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	INKA1 (inka box actin regulator 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Inka1 (inka box actin regulator 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	inka1a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	inka1b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	inka1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	117,552,875 - 117,554,565 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	117,552,875 - 117,554,565 (-)	Ensembl				GRCr8
mRatBN7.2	8	108,674,263 - 108,675,953 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	108,674,263 - 108,675,953 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	114,300,737 - 114,302,427 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	112,500,060 - 112,501,750 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	110,342,700 - 110,344,390 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	116,763,149 - 116,764,839 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	116,763,001 - 116,764,780 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	116,117,472 - 116,119,162 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	113,253,800 - 113,255,490 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	107,978,903 - 107,980,593 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

4,4'-sulfonyldiphenol (ISO)

acrylamide (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP)

antirheumatic drug (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bromobenzene (EXP)

cadmium dichloride (ISO)

camptothecin (ISO)

cisplatin (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

doxorubicin (ISO)

endosulfan (EXP)

fenvalerate (EXP)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

Nutlin-3 (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (EXP)

rac-lactic acid (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sotorasib (ISO)

sunitinib (ISO)

trametinib (ISO)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

neural tube development (ISO)

Cellular Component

cytoplasm (IEA,ISO)

nucleus (IBA,IEA,ISO)

Molecular Function

protein binding (ISO)

protein kinase binding (IBA,ISO)

protein serine/threonine kinase inhibitor activity (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:20175189	PMID:23376485	PMID:26607847

Genomics

Comparative Map Data

Inka1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	117,552,875 - 117,554,565 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	117,552,875 - 117,554,565 (-)	Ensembl				GRCr8
mRatBN7.2	8	108,674,263 - 108,675,953 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	108,674,263 - 108,675,953 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	114,300,737 - 114,302,427 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	112,500,060 - 112,501,750 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	110,342,700 - 110,344,390 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	116,763,149 - 116,764,839 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	116,763,001 - 116,764,780 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	116,117,472 - 116,119,162 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	113,253,800 - 113,255,490 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	107,978,903 - 107,980,593 (-)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

INKA1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	49,803,261 - 49,805,030 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	49,803,240 - 49,805,030 (+)	Ensembl			hg38	GRCh38
GRCh37	3	49,840,694 - 49,842,463 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	49,815,691 - 49,817,467 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	49,806,165 - 49,807,990 (+)	NCBI		Celera
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	49,899,736 - 49,901,512 (+)	NCBI		HuRef
CHM1_1	3	49,792,748 - 49,794,524 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	49,833,138 - 49,834,907 (+)	NCBI		T2T-CHM13v2.0

Inka1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	107,861,422 - 107,863,078 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	107,861,422 - 107,863,078 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	107,984,223 - 107,985,916 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	107,984,223 - 107,985,879 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	107,886,554 - 107,888,247 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	107,842,327 - 107,843,980 (-)	NCBI		MGSCv36	mm8
Celera	9	107,592,634 - 107,594,327 (-)	NCBI		Celera
Cytogenetic Map	9	F1	NCBI
cM Map	9	59.07	NCBI

Inka1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955532	1,695,956 - 1,697,485 (+)	Ensembl
ChiLan1.0	NW_004955532	1,695,956 - 1,697,521 (+)	NCBI	ChiLan1.0	ChiLan1.0

INKA1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	49,789,227 - 49,791,262 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	49,793,983 - 49,796,037 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	49,734,616 - 49,736,838 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	50,971,208 - 50,973,030 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	50,971,394 - 50,972,993 (+)	Ensembl			panPan2	panpan1.1

INKA1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	39,469,103 - 39,477,169 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	39,469,146 - 39,470,857 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	39,389,947 - 39,398,662 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	39,825,978 - 39,834,536 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	39,826,021 - 39,827,732 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	39,193,011 - 39,201,745 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	39,597,246 - 39,605,713 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	39,876,813 - 39,885,535 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Inka1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	64,649,269 - 64,651,526 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936529	1,410,201 - 1,412,023 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936529	1,410,244 - 1,412,023 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

INKA1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	13	32,329,872 - 32,332,167 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	35,509,658 - 35,511,418 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

INKA1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	11,206,066 - 11,208,653 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	11,206,914 - 11,209,867 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	155,789,672 - 155,791,446 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Inka1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	3,718,573 - 3,721,001 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624730	3,717,980 - 3,720,343 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Inka1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	99,315,896 - 99,317,584 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Inka1
18 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	23
Count of miRNA genes:	22
Interacting mature miRNAs:	23
Transcripts:	ENSRNOT00000026216
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	105462581	132782436	Rat
1549909	Stresp11	Stress response QTL 11	6.83	0.0019	stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	8	82352698	127352698	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
9590292	Uminl3	Urine mineral level QTL 3	3.62	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	8	80768445	125768445	Rat
8694446	Bw170	Body weight QTL 170	12.07	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	8	80768445	125768445	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
10450865	Bw175	Body weight QTL 175	4.1		total fat pad mass (VT:0015008)	adipose tissue molecular composition measurement (CMO:0000484)	8	84192326	129192326	Rat
724539	Cm19	Cardiac mass QTL 19	2.6		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	8	103375781	129871912	Rat
738011	Anxrr9	Anxiety related response QTL 9	6.1		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	8	102413464	132782436	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
634332	Pia18	Pristane induced arthritis QTL 18	4		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	84192326	132782436	Rat
2300181	Bmd55	Bone mineral density QTL 55	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	85348065	130348065	Rat
631217	Activ1	Activity QTL 1	15.9		voluntary movement trait (VT:0003491)	number of photobeam interruptions in an experimental apparatus (CMO:0001517)	8	111249511	117802327	Rat
1300171	Bp184	Blood pressure QTL 184	3.66		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	8	79394435	132782436	Rat
2313400	Anxrr25	Anxiety related response QTL 25			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	8	98145073	122898010	Rat
8694200	Abfw4	Abdominal fat weight QTL 4	9.07	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	8	80768445	125768445	Rat
8694392	Bw161	Body weight QTL 161	8.06	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	8	80768445	125768445	Rat
61437	Cia6	Collagen induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	8	91340911	131690273	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	79	78	49	84	49	6	332	184	11	142	75	91	29	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108187	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128059	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473954	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000026216 ⟹ ENSRNOP00000026216

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	117,552,875 - 117,554,565 (-)	Ensembl
mRatBN7.2 Ensembl	8	108,674,263 - 108,675,953 (-)	Ensembl
Rnor_6.0 Ensembl	8	116,763,001 - 116,764,780 (-)	Ensembl

RefSeq Acc Id:

NM_001108187 ⟹ NP_001101657

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	117,552,875 - 117,554,565 (-)	NCBI
mRatBN7.2	8	108,674,263 - 108,675,953 (-)	NCBI
Rnor_6.0	8	116,763,149 - 116,764,839 (-)	NCBI
Rnor_5.0	8	116,117,472 - 116,119,162 (-)	NCBI
RGSC_v3.4	8	113,253,800 - 113,255,490 (-)	RGD
Celera	8	107,978,903 - 107,980,593 (-)	RGD

Sequence:

show sequence

TGTTGGGGCGGCAGCGGCCGGAGCTACTGAGGGAGTAAGGAGCCTTGGAGTAAGGCAAGGGTGA
GGACGCCACTAGCGGGCCGACTCGGCCCACTCTGCGCCGCTCCCGCGGGTGATCGGCGGTGAGC
GGGCGGACCTGGAGAGTGTTCAGCACCAGCACCAACATGCACAGCGCTCGGCTTGACAGTTTCC
TGAGCCAGCTCCGCTGGGAACTGTTGTGTGCTCGGGACACAGCCTCACCTCCAATGCCTGGCCC
ACTGCAACCAAAACCTAAAACTGATCAAAATATACAGCCCAAGCGCCGGTTCAGGGCCTCCGAT
GTTTTGGAAGAGGACTCTGTCTGCTGTGTAGAAGAGGAAGAGGAGGAAGGCTTGGTAGCAGAAG
ACAGGGGTGCACCGCTGGGGTGTCCTAGGGAACATGCCCTAGATTGGGACTCTGGCTTCTCAGA
GGTGTCAGGCAGTACATGGCGAGAAGAAGAGCTGTCTGTACCCCGGCGCCAGGCACCCCCAGAA
CGTCCACCTCATAGCCAGCGTTTCTCAGTGAGTGACCTCCCCGTGCGCAGTAGGGCAGCTGTAA
CCAACATACCTCCTGCCCACCGTCCAAGGCCCAAGTCCACCCCTGATGCTTGCCTGGAACACTG
GCAGGGATTGGAAGCAGAGGACTGGACGGCAGCCCTGCTGAACAGGGGCCGCAGTCGGCAGCCC
CTGGTGCTAGGGGATAACTGTTTTGCTGATTTAGTTCACAATTGGATGGAGTTGCCCGAAGCGA
CCAGTGAAGGAAGTGATGGAGATGTTCCCCGAGCCCGTGCTCGACCCCCCCAGTTCCTGCTTGG
TCTCTCTGAGCAGCTACGGCGTAGGTTGGCCAGGGCTCGACGGACAGCTATGGCAGGCAAGAGG
TTGTCATGCCCACCTCGCCCAGAACCTGACCTGCCTGCGGACATTTCACGATTTGCAGCCCTCA
TGAACTGTCGAAGCCGCCAACCTATTATCTACAATGATGTCAGCTACCTCTGACCCTGCCCTCC
AGCTAGAGACAATAAAGTTTTTTGGTTTTTTTTCTAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101657	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL77206	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000026216
	ENSRNOP00000026216.4

RefSeq Acc Id:

NP_001101657 ⟸ NM_001108187

- UniProtKB:

D4AA62 (UniProtKB/TrEMBL), A6I321 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MHSARLDSFLSQLRWELLCARDTASPPMPGPLQPKPKTDQNIQPKRRFRASDVLEEDSVCCVEE
EEEEGLVAEDRGAPLGCPREHALDWDSGFSEVSGSTWREEELSVPRRQAPPERPPHSQRFSVSD
LPVRSRAAVTNIPPAHRPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVLGDNCFADLV
HNWMELPEATSEGSDGDVPRARARPPQFLLGLSEQLRRRLARARRTAMAGKRLSCPPRPEPDLP
ADISRFAALMNCRSRQPIIYNDVSYL

hide sequence

Ensembl Acc Id:

ENSRNOP00000026216 ⟸ ENSRNOT00000026216

Protein Domains

FAM212

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4AA62-F1-model_v2	AlphaFold	D4AA62	1-282	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696286

Promoter ID:

EPDNEW_R6811

Type:

single initiation site

Name:

Fam212a_1

Description:

family with sequence similarity 212, member A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	116,764,842 - 116,764,902	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1560778	AgrOrtholog
BioCyc Gene	G2FUF-29164	BioCyc
Ensembl Genes	ENSRNOG00000019363	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000026216	ENTREZGENE
	ENSRNOT00000026216.8	UniProtKB/TrEMBL
Gene3D-CATH	Phosphorylase Kinase, domain 1	UniProtKB/TrEMBL
InterPro	FAM212	UniProtKB/TrEMBL
	Inka	UniProtKB/TrEMBL
KEGG Report	rno:316001	UniProtKB/TrEMBL
NCBI Gene	316001	ENTREZGENE
PANTHER	PAK4-INHIBITOR INKA1	UniProtKB/TrEMBL
	PTHR28615	UniProtKB/TrEMBL
Pfam	FAM212	UniProtKB/TrEMBL
PhenoGen	Inka1	PhenoGen
RatGTEx	ENSRNOG00000019363	RatGTEx
UniProt	A6I321	ENTREZGENE, UniProtKB/TrEMBL
	D4AA62	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-04-30	Inka1	inka box actin regulator 1	Fam212a	family with sequence similarity 212, member A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-12-06	Fam212a	family with sequence similarity 212, member A	Fam212a	family with sequence similarity 212, member A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-12-06	Fam212a	family with sequence similarity 212, member A	RGD1560778	similar to RIKEN cDNA 6530418L21	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	RGD1560778	similar to RIKEN cDNA 6530418L21	RGD1560778_predicted	similar to RIKEN cDNA 6530418L21 (predicted)	'predicted' is removed	2292626	APPROVED
2006-03-07	RGD1560778_predicted	similar to RIKEN cDNA 6530418L21 (predicted)	LOC316001	similar to RIKEN cDNA 6530418L21	Symbol and Name status set to approved	1299863	APPROVED
2006-02-09	LOC316001	similar to RIKEN cDNA 6530418L21			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message