Advanced Search (OLGA)

Gene: Ggnbp1 (gametogenetin binding protein 1) Rattus norvegicus

Analyze

Symbol:

Ggnbp1

Name:

gametogenetin binding protein 1

RGD ID:

1359729

Description:

Predicted to be involved in mitochondrial fission. Predicted to be located in Golgi apparatus; mitochondrial intermembrane space; and plasma membrane. Orthologous to human GGNBP1 (gametogenetin binding protein 1 (pseudogene)); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

gametogenetin-binding protein 1; MGC124911

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Is Marker For:

Strains: DA.E3-(RT1-DMa-Ggnbp1)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	5,111,734 - 5,118,034 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	5,101,165 - 5,118,030 (+)	Ensembl				GRCr8
mRatBN7.2	20	5,109,849 - 5,116,185 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	5,099,311 - 5,116,183 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	5,835,571 - 5,841,871 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	5,197,314 - 5,203,615 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	5,675,460 - 5,681,755 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,618,973 - 5,625,320 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,619,012 - 5,625,320 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	7,684,411 - 7,690,734 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	5,265,353 - 5,271,653 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	6,690,509 - 6,696,809 (+)	NCBI		Celera
RGSC_v3.1	20	5,265,579 - 5,271,875 (+)	NCBI
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

1,2-dichloroethane (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,4'-trichlorobiphenyl (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

aristolochic acid A (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

dextran sulfate (ISO)

doxorubicin (EXP)

endosulfan (EXP)

fenthion (ISO)

furan (EXP)

lead nitrate (EXP)

methidathion (ISO)

paracetamol (EXP)

PCB138 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell differentiation (IEA)

mitochondrial fission (IEA,ISO,ISS)

spermatogenesis (IEA)

Cellular Component

cytoplasm (IEA)

Golgi apparatus (IEA,ISO)

membrane (IEA)

mitochondrial intermembrane space (IEA,ISO,ISS)

plasma membrane (IEA,ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Identification and characterization of a novel testicular germ cell-specific gene Ggnbp1.	Zhou Y, etal., Mol Reprod Dev 2005 Mar;70(3):301-7.

Additional References at PubMed

PMID:12477932	PMID:15489334	PMID:15642376	PMID:19208545

Genomics

Comparative Map Data

Ggnbp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	5,111,734 - 5,118,034 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	5,101,165 - 5,118,030 (+)	Ensembl				GRCr8
mRatBN7.2	20	5,109,849 - 5,116,185 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	5,099,311 - 5,116,183 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	5,835,571 - 5,841,871 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	5,197,314 - 5,203,615 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	5,675,460 - 5,681,755 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,618,973 - 5,625,320 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,619,012 - 5,625,320 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	7,684,411 - 7,690,734 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	5,265,353 - 5,271,653 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	6,690,509 - 6,696,809 (+)	NCBI		Celera
RGSC_v3.1	20	5,265,579 - 5,271,875 (+)	NCBI
Cytogenetic Map	20	p12	NCBI

GGNBP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	33,583,699 - 33,589,026 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	33,583,699 - 33,589,026 (+)	Ensembl			hg38	GRCh38
GRCh37	6	33,551,476 - 33,556,803 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	33,659,493 - 33,664,781 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	6	35,105,855 - 35,111,182 (+)	NCBI		Celera
Cytogenetic Map	6	p21.31	NCBI
HuRef	6	33,292,939 - 33,298,266 (+)	NCBI		HuRef
CHM1_1	6	33,553,814 - 33,559,139 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	33,404,889 - 33,410,216 (+)	NCBI		T2T-CHM13v2.0

Ggnbp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	27,237,009 - 27,255,352 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	27,236,961 - 27,256,598 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	27,018,035 - 27,036,378 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	27,017,987 - 27,037,624 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	27,166,204 - 27,173,323 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	26,756,848 - 26,763,965 (+)	NCBI		MGSCv36	mm8
Celera	17	27,565,611 - 27,572,731 (+)	NCBI		Celera
Cytogenetic Map	17	A3.3	NCBI
cM Map	17	13.6	NCBI

GGNBP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	2,949,364 - 2,970,699 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	2,969,250 - 2,993,686 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	3,285,110 - 3,309,553 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	3,290,064 - 3,293,284 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	2,952,214 - 2,976,545 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	3,033,186 - 3,057,592 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	3,131,316 - 3,155,755 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

GGNBP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	7	29,816,048 - 29,821,351 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	34,273,785 - 34,279,077 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Ggnbp1
56 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	76
Count of miRNA genes:	67
Interacting mature miRNAs:	70
Transcripts:	ENSRNOT00000000577
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	4189476	49189476	Rat
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1533200	5306452	Rat
61474	Eae1	Experimental allergic encephalomyelitis QTL 1	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	20	1	6693431	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3626323	10078622	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	6693431	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3626323	9244918	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1	14100378	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Markers in Region

BE102269

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	5,109,413 - 5,109,582 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	5,618,551 - 5,618,719	NCBI	Rnor6.0
Rnor_5.0	20	7,683,965 - 7,684,133	UniSTS	Rnor5.0
RGSC_v3.4	20	5,264,884 - 5,265,052	UniSTS	RGSC3.4
Celera	20	6,690,096 - 6,690,264	UniSTS
RH 3.4 Map	20	54.8	UniSTS
Cytogenetic Map	20	p12	UniSTS

Related Rat Strains

The following Strains have been annotated to Ggnbp1

DA.E3-(RT1-DMa-Ggnbp1)

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	11	65	157	89	88	57	77	57	6	331	174	10	136	77	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001009972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY529104	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105838	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000577 ⟹ ENSRNOP00000000577

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	5,111,671 - 5,118,030 (+)	Ensembl
mRatBN7.2 Ensembl	20	5,109,875 - 5,116,183 (+)	Ensembl
Rnor_6.0 Ensembl	20	5,619,012 - 5,625,320 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119446 ⟹ ENSRNOP00000076712

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	5,101,165 - 5,118,030 (+)	Ensembl
mRatBN7.2 Ensembl	20	5,099,311 - 5,116,183 (+)	Ensembl

RefSeq Acc Id:

NM_001009972 ⟹ NP_001009972

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	5,111,734 - 5,118,034 (+)	NCBI
mRatBN7.2	20	5,109,883 - 5,116,185 (+)	NCBI
Rnor_6.0	20	5,619,020 - 5,625,320 (+)	NCBI
Rnor_5.0	20	7,684,411 - 7,690,734 (+)	NCBI
RGSC_v3.4	20	5,265,353 - 5,271,653 (+)	RGD
Celera	20	6,690,509 - 6,696,809 (+)	RGD

Sequence:

show sequence

AGTTGGTCCCGGGCTGGCTGCCATGACTTCTCCCTGAGTCAGGGTCCTTCTCAGGATGGCAGCC
CAGGCTCGGACCCCTCGGTCTCGGATCTTAGGCTGTTCCTCCATGCTGCGCTTTCTCAGAAGCC
TGGTAGGGAGTAAGGGCAGTTCTAAGAGCTCTAACAGGCCTCTGAACAGGAGCCAGCCCAGCTC
CTCACCAGAGCAGGATGTTGTCTCCCCAACGATGGGCCACCAGGGAGGTTGTGGGAGGAAGGAG
ACCCGGCCCAGGGTCCTCTCTGCAACTTCCTCTAATGGGAAGAGGGAGCCACGGCCCAGGGTCC
TCTCTGCAGCTCCCTCCAACCAGAGGCTGCGTGATGCCTCTGGGCTGGGCACTGGGGACACAGG
GTCTCAGACCCTCACCTCCAAGGATGTCCTGAAGCTAAGGGCCCAGGGTGTTGAGGTAACATCA
GTCCCTACCAGAGGAACCTGGGAGGTTCTGGAGCACCTGCCTGAGAAGAAAGGAGAGGAGGGAG
AGCCAGCGGGAGAGGTCTCAGGGGCCTCAGACAGGGCGCACTTTGGCCAGGCCCTGGAGGCAGA
ACAAGGATGCCTGCAGTGGGTTTCGGGACCAATGGTGCTCCCCCCTGAGGCCTTCATCAAGGAG
GAAGAGGATGAGCACTGCCTAATTGACTTTGGAGACCTCAGACTGTCCTCTTGCAAGGTGGGAT
CCACCCCGTGGAACTATCTCCTTGGCTTGTACAAACAGCTCCAGAAGTCGGCCATGACCAAGGC
TCAGAGACCAGATGCAGATGCGCCTCAGTTTGCTCTCAAGGATAGCTCGCCCACCGAGGAGAGA
GGGGAGAGAGAGGAAGCGGTGGACGAGAGCAGCCTCAAGTGGTGCGCTCCGCGCGCCTCCAGCG
ACGACAGCAACCTCAAGTGGTGCGCCCCGCGCAACTCCACCTACCAATCGCCGCTGCAGAAGAC
GTTTAGGTCCACAGACACAGTGGGTTTCGTGGAGTCAGAGCTGAAGAAGATTCTAGCAGTGCAA
CGGGAGGCTCGCCTCTGGAAGGTGGGCAACCCTGAGGGACGGGAGCTGCTGACCCAGCCGGACA
TCACGCTGGAGGAGGCTGGCATGGTGGATGGTCAGCATCTGCTCCTGGAAGAGATGGACGAGAT
GGGAAACTGGCCCCCTCCGGAGTGAGGCCCGTGCTGGCAGGAGCCCACCGTGCCCACACCCCTG
CGACCCCAGTCCGACGTGTGTCTCTCCTTGGGACACACGGAAGGAGTCCCTGGGGCCCTGGGTT
TGGGGGATGAGTAGCATCCTGTGTGTGTGTGTGTGTGGTGGGCCTGCCCAGCACCCGTCATTAG
ACTCCCTCAGATGATGTTATTAATAAAAGCTTATTTAACTTGAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001009972	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI05839	(Get FASTA)	NCBI Sequence Viewer
	AAS93935	(Get FASTA)	NCBI Sequence Viewer
	EDL96873	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000577
	ENSRNOP00000000577.4
GenBank Protein	Q5J2D6	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009972 ⟸ NM_001009972

- UniProtKB:

Q5J2D6 (UniProtKB/Swiss-Prot), A6JJK7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAAQARTPRSRILGCSSMLRFLRSLVGSKGSSKSSNRPLNRSQPSSSPEQDVVSPTMGHQGGCG
RKETRPRVLSATSSNGKREPRPRVLSAAPSNQRLRDASGLGTGDTGSQTLTSKDVLKLRAQGVE
VTSVPTRGTWEVLEHLPEKKGEEGEPAGEVSGASDRAHFGQALEAEQGCLQWVSGPMVLPPEAF
IKEEEDEHCLIDFGDLRLSSCKVGSTPWNYLLGLYKQLQKSAMTKAQRPDADAPQFALKDSSPT
EERGEREEAVDESSLKWCAPRASSDDSNLKWCAPRNSTYQSPLQKTFRSTDTVGFVESELKKIL
AVQREARLWKVGNPEGRELLTQPDITLEEAGMVDGQHLLLEEMDEMGNWPPPE

hide sequence

Ensembl Acc Id:

ENSRNOP00000000577 ⟸ ENSRNOT00000000577

Ensembl Acc Id:

ENSRNOP00000076712 ⟸ ENSRNOT00000119446

Protein Domains

Ubiquitin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5J2D6-F1-model_v2	AlphaFold	Q5J2D6	1-373	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701427

Promoter ID:

EPDNEW_R11949

Type:

initiation region

Name:

Ggnbp1_1

Description:

gametogenetin binding protein 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	5,619,014 - 5,619,074	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359729	AgrOrtholog
BioCyc Gene	G2FUF-4497	BioCyc
Ensembl Genes	ENSRNOG00000000486	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000000577	ENTREZGENE
	ENSRNOT00000000577.7	UniProtKB/Swiss-Prot
Gene3D-CATH	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7452960	IMAGE-MGC_LOAD
InterPro	Ub_USP-typ	UniProtKB/Swiss-Prot
KEGG Report	rno:494520	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124911	IMAGE-MGC_LOAD
NCBI Gene	494520	ENTREZGENE
Pfam	Ubiquitin_3	UniProtKB/Swiss-Prot
PhenoGen	Ggnbp1	PhenoGen
RatGTEx	ENSRNOG00000000486	RatGTEx
UniProt	A0A8I5Y5H8_RAT	UniProtKB/TrEMBL
	A6JJK7	ENTREZGENE, UniProtKB/TrEMBL
	GGNB1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-08-01	Ggnbp1	gametogenetin binding protein 1	Ggnbp1	gametogenetin-binding protein 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-29	Ggnbp1	gametogenetin-binding protein 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message