Wrap53 (WD repeat containing, antisense to TP53)

Gene: Wrap53 (WD repeat containing, antisense to TP53) Rattus norvegicus

Analyze

Symbol:

Wrap53

Name:

WD repeat containing, antisense to TP53

RGD ID:

1359624

Description:

Predicted to enable several functions, including identical protein binding activity; telomerase RNA binding activity; and ubiquitin protein ligase binding activity. Predicted to be involved in several processes, including RNA localization to Cajal body; positive regulation of double-strand break repair; and telomere organization. Predicted to be located in cytosol; nuclear body; and site of double-strand break. Predicted to be part of telomerase holoenzyme complex. Predicted to be active in Cajal body. Human ortholog(s) of this gene implicated in autosomal recessive dyskeratosis congenita 3; colorectal cancer; head and neck squamous cell carcinoma; lung non-small cell carcinoma; and ovarian cancer. Orthologous to human WRAP53 (WD repeat containing antisense to TP53); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

MGC94565; similar to hypothetical protein MGC28622; telomerase Cajal body protein 1; WD repeat domain 79; WD repeat-containing protein 79; WD repeat-containing protein WRAP53; WD40 repeat-containing protein antisense to TP53; WD40 repeat-containing protein antisense to TP53 gene homolog; WD40 repeat-containing protein encoded by RNA antisense to p53; Wdr79

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	WRAP53 (WD repeat containing antisense to TP53)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Wrap53 (WD repeat containing, antisense to Trp53)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Wrap53 (WD repeat containing antisense to TP53)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	WRAP53 (WD repeat containing antisense to TP53)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	WRAP53 (WD repeat containing antisense to TP53)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Wrap53 (WD repeat containing antisense to TP53)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	WRAP53 (WD repeat containing antisense to TP53)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	WRAP53 (WD repeat containing antisense to TP53)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Wrap53 (WD repeat containing antisense to TP53)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Wrap53 (WD repeat containing, antisense to Trp53)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	WRAP53 (WD repeat containing antisense to TP53)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	wrap53 (WD repeat containing, antisense to TP53)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SWT21	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	WDR79	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tcab-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	wrap53	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	54,780,873 - 54,797,919 (-)	NCBI		GRCr8
mRatBN7.2	10	54,282,092 - 54,299,908 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,282,105 - 54,298,929 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	58,944,501 - 58,961,275 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,433,045 - 58,449,818 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	53,940,731 - 53,957,518 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,169,024 - 56,185,800 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,169,025 - 56,185,857 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	55,914,380 - 55,931,438 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,380,914 - 56,398,501 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	56,394,537 - 56,412,124 (-)	NCBI
Celera	10	53,436,325 - 53,453,155 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Autosomal Recessive Dyskeratosis Congenita (ISO)

autosomal recessive dyskeratosis congenita 3 (ISO)

Body Weight (ISO)

breast cancer (ISO)

colorectal cancer (ISO)

common variable immunodeficiency (ISO)

congenital myasthenic syndrome 2A (ISO)

Diamond-Blackfan anemia (ISO)

dyskeratosis congenita (ISO)

esophagus squamous cell carcinoma (ISO)

genetic disease (ISO)

glottis squamous cell carcinoma (ISO)

head and neck squamous cell carcinoma (ISO)

hepatocellular carcinoma (ISO)

Hereditary Neoplastic Syndromes (ISO)

Li-Fraumeni syndrome (ISO)

Li-Fraumeni syndrome 1 (ISO)

lung adenocarcinoma (ISO)

lung non-small cell carcinoma (ISO)

Lymphatic Metastasis (ISO)

nasopharynx carcinoma (ISO)

ovarian cancer (ISO)

rectal benign neoplasm (ISO)

very long chain acyl-CoA dehydrogenase deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

5-methylcytosine (ISO)

aflatoxin B1 (ISO)

antirheumatic drug (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

caffeine (ISO)

calcitriol (ISO)

coumarin (ISO)

coumestrol (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diazinon (ISO)

elemental selenium (ISO)

FR900359 (ISO)

indometacin (ISO)

leflunomide (ISO)

ozone (ISO)

paracetamol (EXP)

PCB138 (EXP)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

testosterone (ISO)

thioacetamide (EXP)

valproic acid (ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Cajal body organization (IBA,ISO,ISS)

DNA repair (IEA)

positive regulation of DNA repair (ISO,ISS)

positive regulation of double-strand break repair (ISO,ISS)

positive regulation of double-strand break repair via homologous recombination (ISO,ISS)

positive regulation of double-strand break repair via nonhomologous end joining (ISO,ISS)

positive regulation of establishment of protein localization to telomere (ISO)

protein localization to Cajal body (ISO,ISS)

RNA folding (ISO,ISS)

scaRNA localization to Cajal body (ISO,ISS)

telomerase RNA localization to Cajal body (ISO)

telomere formation via telomerase (ISO,ISS)

telomere maintenance via telomerase (ISO,ISS)

Cellular Component

Cajal body (IBA,ISO,ISS)

chromosome, telomeric region (IEA)

cytosol (IEA,ISO)

nuclear body (ISO)

nucleoplasm (ISO)

site of double-strand break (ISO,ISS)

telomerase holoenzyme complex (ISO,ISS)

Molecular Function

histone binding (ISO)

identical protein binding (ISO)

protein binding (ISO)

protein-containing complex binding (ISO)

protein-folding chaperone binding (ISO)

RNA binding (IBA,ISO,ISS)

telomerase RNA binding (ISO,ISS)

ubiquitin protein ligase binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Nuclear expression of WRAP53β is associated with a positive response to radiotherapy and improved overall survival in patients with head and neck squamous cell carcinoma.	Garvin S, etal., Oral Oncol. 2015 Jan;51(1):24-30. doi: 10.1016/j.oraloncology.2014.10.003. Epub 2014 Oct 27.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Downregulation of the cancer susceptibility protein WRAP53beta in epithelial ovarian cancer leads to defective DNA repair and poor clinical outcome.	Hedstrom E, etal., Cell Death Dis. 2015 Oct 1;6:e1892. doi: 10.1038/cddis.2015.250.
4.	null	JRS Domain-based curation
5.	Investigation of long noncoding RNAs expression profile as potential serum biomarkers in patients with hepatocellular carcinoma.	Kamel MM, etal., Transl Res. 2016 Feb;168:134-45. doi: 10.1016/j.trsl.2015.10.002. Epub 2015 Oct 24.
6.	Promoter methylation of Wrap53α, an antisense transcript of p53, is associated with the poor prognosis of patients with non-small cell lung cancer.	Kim DS, etal., Oncol Lett. 2018 Nov;16(5):5823-5828. doi: 10.3892/ol.2018.9404. Epub 2018 Sep 5.
7.	Association of common WRAP 53 variant with ovarian cancer risk in the Polish population.	Mędrek K, etal., Mol Biol Rep. 2013 Mar;40(3):2145-7. doi: 10.1007/s11033-012-2273-9. Epub 2012 Nov 29.
8.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
9.	Expression of WDR79 is associated with TP53 mutation and poor prognosis in surgically resected non-small cell lung cancer.	Peng J, etal., J Cancer. 2019 Jun 2;10(13):3046-3053. doi: 10.7150/jca.30587. eCollection 2019.
10.	Overexpression of WRAP53 is associated with development and progression of esophageal squamous cell carcinoma.	Rao X, etal., PLoS One. 2014 Mar 13;9(3):e91670. doi: 10.1371/journal.pone.0091670. eCollection 2014.
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Single-strand conformational polymorphism analysis of a common single nucleotide variation in WRAP53 gene, rs2287499, and evaluating its association in relation to breast cancer risk and prognosis among Iranian-Azeri population.	Sedaie Bonab A, etal., Med Oncol. 2014 Sep;31(9):168. doi: 10.1007/s12032-014-0168-4. Epub 2014 Aug 19.
14.	The Sub-Cellular Localization of WRAP53 Has Prognostic Impact in Breast Cancer.	Silwal-Pandit L, etal., PLoS One. 2015 Oct 13;10(10):e0139965. doi: 10.1371/journal.pone.0139965. eCollection 2015.
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.	TCAB1: a potential target for diagnosis and therapy of head and neck carcinomas.	Sun CK, etal., Mol Cancer. 2014 Jul 28;13:180. doi: 10.1186/1476-4598-13-180.
17.	WRAP53β, survivin and p16INK4a expression as potential predictors of radiotherapy/chemoradiotherapy response in T2N0-T3N0 glottic laryngeal cancer.	Tiefenböck-Hansson K, etal., Oncol Rep. 2017 Oct;38(4):2062-2068. doi: 10.3892/or.2017.5898. Epub 2017 Aug 11.
18.	Epstein-Barr virus-induced up-regulation of TCAB1 is involved in the DNA damage response in nasopharyngeal carcinoma.	Wang K, etal., Sci Rep. 2017 Jun 12;7(1):3218. doi: 10.1038/s41598-017-03156-3.
19.	The prognostic factors and multiple biomarkers in young patients with colorectal cancer.	Wang MJ, etal., Sci Rep. 2015 May 27;5:10645. doi: 10.1038/srep10645.
20.	Clinical, cellular, and bioinformatic analyses reveal involvement of WRAP53 overexpression in carcinogenesis of lung adenocarcinoma.	Yuan XS, etal., Tumour Biol. 2017 Mar;39(3):1010428317694309. doi: 10.1177/1010428317694309.
21.	WRAP53 is an independent prognostic factor in rectal cancer- a study of Swedish clinical trial of preoperative radiotherapy in rectal cancer patients.	Zhang H, etal., BMC Cancer. 2012 Jul 17;12:294. doi: 10.1186/1471-2407-12-294.
22.	Disruption of telomerase trafficking by TCAB1 mutation causes dyskeratosis congenita.	Zhong F, etal., Genes Dev. 2011 Jan 1;25(1):11-6. doi: 10.1101/gad.2006411.
23.	Oncogenic Activity of Wrap53 in Human Colorectal Cancer In Vitro and in Nude Mouse Xenografts.	Zhu Y, etal., Med Sci Monit. 2018 Sep 3;24:6129-6136. doi: 10.12659/MSM.910214.

Additional References at PubMed

PMID:15489334	PMID:19179534	PMID:19285445	PMID:20351177	PMID:21072240	PMID:22547674	PMID:23685356	PMID:25467444	PMID:25512560	PMID:26170453	PMID:26734725	PMID:27715493
PMID:29695869	PMID:29804836

Genomics

Comparative Map Data

Wrap53
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	54,780,873 - 54,797,919 (-)	NCBI		GRCr8
mRatBN7.2	10	54,282,092 - 54,299,908 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	54,282,105 - 54,298,929 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	58,944,501 - 58,961,275 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	58,433,045 - 58,449,818 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	53,940,731 - 53,957,518 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	56,169,024 - 56,185,800 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	56,169,025 - 56,185,857 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	55,914,380 - 55,931,438 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	56,380,914 - 56,398,501 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	56,394,537 - 56,412,124 (-)	NCBI
Celera	10	53,436,325 - 53,453,155 (-)	NCBI		Celera
Cytogenetic Map	10	q24	NCBI

WRAP53
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	7,686,071 - 7,703,502 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	7,686,071 - 7,703,502 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	7,589,389 - 7,606,820 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	7,532,520 - 7,547,544 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	17	7,615,750 - 7,633,180 (+)	NCBI		Celera
Cytogenetic Map	17	p13.1	NCBI
HuRef	17	7,482,804 - 7,500,156 (+)	NCBI		HuRef
CHM1_1	17	7,598,524 - 7,615,973 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	7,590,175 - 7,607,622 (+)	NCBI		T2T-CHM13v2.0

Wrap53
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	69,452,580 - 69,471,076 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	69,452,584 - 69,471,081 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	69,561,754 - 69,580,250 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	69,561,758 - 69,580,255 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	69,375,256 - 69,392,826 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	69,377,949 - 69,395,519 (-)	NCBI		MGSCv36	mm8
Celera	11	76,524,707 - 76,542,284 (-)	NCBI		Celera
Cytogenetic Map	11	B3	NCBI
cM Map	11	42.81	NCBI

Wrap53
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955467	9,225,506 - 9,240,756 (-)	NCBI	ChiLan1.0	ChiLan1.0

WRAP53
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	15,280,889 - 15,298,965 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	17,246,094 - 17,265,011 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	7,715,897 - 7,735,873 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	7,707,220 - 7,723,410 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	7,707,221 - 7,723,394 (+)	Ensembl	panpan1.1		panPan2

WRAP53
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	32,574,153 - 32,586,222 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	32,574,134 - 32,594,333 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	32,712,138 - 32,725,180 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	32,677,789 - 32,690,832 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	32,678,578 - 32,690,834 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	32,645,668 - 32,658,710 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	32,601,891 - 32,614,933 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	32,780,842 - 32,793,885 (+)	NCBI		UU_Cfam_GSD_1.0

Wrap53
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	47,461,298 - 47,478,596 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936595	936,487 - 952,791 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936595	936,184 - 952,784 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

WRAP53
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	52,954,669 - 52,968,364 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	52,954,674 - 52,968,371 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	55,205,960 - 55,219,648 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

WRAP53
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	7,065,531 - 7,085,590 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	7,066,333 - 7,085,625 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	14,323,308 - 14,343,301 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Wrap53
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	10,283,984 - 10,296,729 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624786	10,283,721 - 10,296,568 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Wrap53
61 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	189
Count of miRNA genes:	146
Interacting mature miRNAs:	165
Transcripts:	ENSRNOT00000014261
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18167841	63167841	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	19606483	64606483	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	19606483	64606483	Rat
1554317	Bmd4	Bone mineral density QTL 4	9.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	19816042	99406971	Rat
1581497	Esta1	Estrogen-induced thymic atrophy QTL 1			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	21329805	61345413	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22427500	90627625	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
70224	Eae3	Experimental allergic encephalomyelitis QTL 3	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	10	26521957	61345413	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	26521957	98003205	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	26521957	98952741	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	26944628	71944628	Rat
10402859	Bp381	Blood pressure QTL 381		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
2292441	Bp308	Blood pressure QTL 308			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	27606468	72606468	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28453136	73453136	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29299504	64155584	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	30632053	75632053	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31224026	75632053	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31297439	76297439	Rat
1576319	Cia29	Collagen induced arthritis QTL 29			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	33973921	78973921	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35392267	64155584	Rat
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35392457	63642539	Rat
2317042	Aia20	Adjuvant induced arthritis QTL 20	3.38		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	37565079	82565079	Rat
2317043	Aia7	Adjuvant induced arthritis QTL 7	3.82		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	37565079	82565079	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	41142633	86142633	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41333258	86333258	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	41944526	78307017	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	42323132	87323132	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42323132	87323132	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42323132	87323132	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	42876766	79813922	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44441699	89441699	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44441699	89441699	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44441699	89441699	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45029650	95600334	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47369470	92369470	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	49444551	81709989	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49444551	81709989	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	49444551	81709989	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	49444551	81709989	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	50574707	95574707	Rat
70364	Bp72	Blood pressure QTL 72			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	51121100	96121100	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
1359017	Hrtrt21	Heart rate QTL 21	2.4		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	10	51772940	96772940	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	51774612	95600334	Rat
631535	Cm51	Cardiac mass QTL 51	3		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	10	51786282	91669536	Rat
1578762	Toxo1	Toxoplasma gondii resistance QTL 1			brain integrity trait (VT:0010579)	percentage of study population displaying Toxoplasma gondii brain cysts at a point in time (CMO:0002028)	10	52200030	59378278	Rat
1354585	Eae18a	Experimental allergic encephalomyelitis QTL 18a	7.5	0.0004	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	53797385	58445852	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	53797385	66979128	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	53797494	98952626	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	22	32	26	12	26			58	28	38	7
Low		21	25	15	7	15	8	11	16	7	3	4	8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001007610	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085446	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085447	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC136563	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC083696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000014261 ⟹ ENSRNOP00000014261

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	54,282,105 - 54,298,929 (-)	Ensembl
Rnor_6.0 Ensembl	10	56,169,025 - 56,185,857 (-)	Ensembl

RefSeq Acc Id:

NM_001007610 ⟹ NP_001007611

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	54,780,875 - 54,797,651 (-)	NCBI
mRatBN7.2	10	54,282,099 - 54,298,876 (-)	NCBI
Rnor_6.0	10	56,169,024 - 56,185,800 (-)	NCBI
Rnor_5.0	10	55,914,380 - 55,931,438 (-)	NCBI
RGSC_v3.4	10	56,380,914 - 56,398,501 (-)	RGD
Celera	10	53,436,325 - 53,453,155 (-)	RGD

Sequence:

show sequence

CGGAAGAGGAAAGCAGACTCGGGGCTGTGCAGTTCTGCGCCGGGACCCCTGGGAACGGTAATGC
AGTCTAGCCTCGGCAGCTGGTAGCTGGCTCAACGAGGCTCGCCTAGTCTCTGCCTTCCGCTAGC
TAAGTCTGCAGAATGAAGACGTCGGAGGAGCTACGCCTAGCTCCGGATAGCCTCCCTTCTGACC
TGGTCCCAGCCCCAGTGCTCCAAGCTTCCCCCGCGGACAAAAATACAGACTCTGAACCGGTGCC
TCCGCCATGCGGTGGAGATGACCAACTCCAGGTAGCCACAGATGCCGTGGCCAGCTCGGTTGTG
TCCCAGGAGCTTCAACAAGGGGACTCAGCTCCTCTGGAAGTAGAATTTAATATTTCCAGTGAGT
TGAGTCCTCGAATCGAGGAGCAAGAAGTTCCTGAAAATGCCAGCCTTCCTGTAGAAGAAACGAA
TCGGCCCGAGTTGGAGTCAGGGGAAGCCATGGAAGGTGTGTCTGAGGAACCCGCTGCAGTGGAT
GAGGGGGACATCTTTTGGAGCTACAGCTTCTCTCAGGTACCCCAATACCTCAGTGGCTCCTGGT
CCGAGTTCAGCACCCGCTCCGAGAACTTCTTGAAAGGTTGCAAGTGGGCCCCTGACGGTTCCTG
TATCTTGACCAATAGTGCTGACAATGTCCTACGGATTTACAACCTGCCCCCAGAACTGTACAGT
GAAAGCGAGCAGGTGGATTATGCCGAAATGGTTCCTGTCCTGCGAATGGTAGAGGGTGACACCA
TCTATGATTACTGCTGGTATTCTCTGATGTCCTCCACCCAGCCAGACACCTCCTATGTGGCCAG
CAGCAGCCGGGAGAACCCAATTCACATCTGGGATGCATTCACTGGAGAACTCCGGGCTTCCTTT
CGCGCTTACAACCACCTGGACGAGTTGACAGCGGCCCACTCACTCTGTTTCTCCCCGGATGGTT
CCCAACTCTTTTGTGGCTTCAACCGGACTGTGCGTGTCTTTTCCACATCCAGGCCTGGCAGAGA
CTGTGAGGTGCGAACCACATTTGCCAAAAAGCAGGGCCAGAGTGGCATCATCTCCTGTCTAGCC
TTTAGTCCAGCCCAGCCCCTCTATGCCTGTGGCTCCTATGGCCGCACCCTGGGCCTGTATGCCT
GGGATGATGGTTCACCTCTTGCCTTGCTGGGGGGCCATCAAGGAGGTATCACCCACCTTTGCTT
TCACCCTGATGGCAACCTCTTCTTCTCAGGAGCCCGAAAGGATGCTGAACTTCTGTGCTGGGAT
CTCCGGCAGCCGGGCCACCTCCTGTGGTCTCTGAGTCGGGAAGTGACCACCAATCAGCGCATCT
ACTTTGATCTGGACCCGAGCGGGCAGTTCCTAGTGAGTGGCAACACCAGTGGAGTTGTCTCCGT
GTGGGACATCAGTGGAGCGTTCAGTGACTGCAAGCAGCTGGAGCCAGTGATGACTTTTCTGCCC
CAGGACGACTGCACCAATGGAGTCAGCCTTCACCCTACCTTGCCTCTGCTGGCCACTGCTTCTG
GCCAGCGCATGTTTCCAGAGCCCACCAATAGCGGGGATGAAGGTGAGCCGGAGCTGGACCTTCC
CCTGCTCTCCCTGCGCCACGCCCATCCTGAATGTCAGCTACAGCTCTGGTGGTGTGGAGGGGGA
CCTGACCCCAGTAACCCTGATGAGGACCAGGATGAGAAGGGACAAGGAAGGACAGAGGCTGTCG
GAATGAGTTAATATAAAGACTTTGTATCAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039085446 ⟹ XP_038941374

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	54,780,873 - 54,796,180 (-)	NCBI
mRatBN7.2	10	54,282,092 - 54,298,534 (-)	NCBI

RefSeq Acc Id:

XM_039085447 ⟹ XP_038941375

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	54,781,777 - 54,797,919 (-)	NCBI
mRatBN7.2	10	54,282,994 - 54,299,908 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001007611	(Get FASTA)	NCBI Sequence Viewer
	XP_038941374	(Get FASTA)	NCBI Sequence Viewer
	XP_038941375	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH83696	(Get FASTA)	NCBI Sequence Viewer
	EDM04869	(Get FASTA)	NCBI Sequence Viewer
	EDM04870	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000014261
	ENSRNOP00000014261.3
	ENSRNOP00055043655
	ENSRNOP00060040641
GenBank Protein	Q5XII5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001007611 ⟸ NM_001007610

- UniProtKB:

Q5XII5 (UniProtKB/Swiss-Prot), A6HFR4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKTSEELRLAPDSLPSDLVPAPVLQASPADKNTDSEPVPPPCGGDDQLQVATDAVASSVVSQEL
QQGDSAPLEVEFNISSELSPRIEEQEVPENASLPVEETNRPELESGEAMEGVSEEPAAVDEGDI
FWSYSFSQVPQYLSGSWSEFSTRSENFLKGCKWAPDGSCILTNSADNVLRIYNLPPELYSESEQ
VDYAEMVPVLRMVEGDTIYDYCWYSLMSSTQPDTSYVASSSRENPIHIWDAFTGELRASFRAYN
HLDELTAAHSLCFSPDGSQLFCGFNRTVRVFSTSRPGRDCEVRTTFAKKQGQSGIISCLAFSPA
QPLYACGSYGRTLGLYAWDDGSPLALLGGHQGGITHLCFHPDGNLFFSGARKDAELLCWDLRQP
GHLLWSLSREVTTNQRIYFDLDPSGQFLVSGNTSGVVSVWDISGAFSDCKQLEPVMTFLPQDDC
TNGVSLHPTLPLLATASGQRMFPEPTNSGDEGEPELDLPLLSLRHAHPECQLQLWWCGGGPDPS
NPDEDQDEKGQGRTEAVGMS

hide sequence

RefSeq Acc Id:

ENSRNOP00000014261 ⟸ ENSRNOT00000014261

RefSeq Acc Id:	XP_038941374 ⟸ XM_039085446
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038941375 ⟸ XM_039085447
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5XII5-F1-model_v2	AlphaFold	Q5XII5	1-532	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697314

Promoter ID:

EPDNEW_R7838

Type:

multiple initiation site

Name:

Wrap53_1

Description:

WD repeat containing, antisense to TP53

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	56,185,858 - 56,185,918	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359624	AgrOrtholog
BioCyc Gene	G2FUF-24541	BioCyc
Ensembl Genes	ENSRNOG00000010520	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055030438	UniProtKB/Swiss-Prot
	ENSRNOG00060028057	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000014261	ENTREZGENE
	ENSRNOT00000014261.6	UniProtKB/Swiss-Prot
	ENSRNOT00055052815	UniProtKB/Swiss-Prot
	ENSRNOT00060048728	UniProtKB/Swiss-Prot
Gene3D-CATH	2.130.10.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7189640	IMAGE-MGC_LOAD
InterPro	WD40/YVTN_repeat-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	WD40_repeat_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:287432	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:94565	IMAGE-MGC_LOAD
NCBI Gene	287432	ENTREZGENE
PANTHER	TELOMERASE CAJAL BODY PROTEIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UNCHARACTERIZED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Wrap53	PhenoGen
PROSITE	WD_REPEATS_REGION	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000010520	RatGTEx
	ENSRNOG00055030438	RatGTEx
	ENSRNOG00060028057	RatGTEx
SMART	WD40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50978	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HFR4	ENTREZGENE, UniProtKB/TrEMBL
	Q5XII5	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2010-05-05	Wrap53	WD repeat containing, antisense to TP53	Wdr79	WD repeat domain 79	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Wdr79	WD repeat domain 79	MGC94565	similar to hypothetical protein MGC28622	Symbol and Name updated	1299863	APPROVED
2005-07-29	MGC94565	similar to hypothetical protein MGC28622			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM