Sapcd1 (suppressor APC domain containing 1)

Advanced Search (OLGA)

Gene: Sapcd1 (suppressor APC domain containing 1) Rattus norvegicus

Analyze

Symbol:

Sapcd1

Name:

suppressor APC domain containing 1

RGD ID:

1359359

Description:

Orthologous to human SAPCD1 (suppressor APC domain containing 1); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Ng23; suppressor APC domain-containing protein 1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,798,124 - 3,800,422 (+)	NCBI		GRCr8
mRatBN7.2	20	3,793,980 - 3,795,767 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,793,967 - 3,795,790 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,493,527 - 4,495,296 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,855,582 - 3,857,351 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,393,487 - 4,395,256 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,018,264 - 5,020,375 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,018,264 - 5,020,150 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	7,091,280 - 7,093,208 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	3,862,654 - 3,864,441 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	3,862,880 - 3,864,623 (+)	NCBI
Celera	20	4,230,730 - 4,232,517 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

proteasome-associated autoinflammatory syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

acrylamide (ISO)

alpha-Zearalanol (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (ISO)

butanal (ISO)

cadmium dichloride (EXP)

cyclosporin A (ISO)

dibutyl phthalate (EXP)

endosulfan (EXP)

perfluorooctanoic acid (EXP)

rac-lactic acid (ISO)

sodium arsenite (ISO)

succimer (ISO)

sunitinib (ISO)

tetrachloromethane (EXP)

trichostatin A (ISO)

triptonide (ISO)

tungsten (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	The genomic sequence and comparative analysis of the rat major histocompatibility complex.	Hurt P, etal., Genome Res 2004 Apr;14(4):631-9.
2.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Sapcd1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,798,124 - 3,800,422 (+)	NCBI		GRCr8
mRatBN7.2	20	3,793,980 - 3,795,767 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,793,967 - 3,795,790 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	4,493,527 - 4,495,296 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,855,582 - 3,857,351 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,393,487 - 4,395,256 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,018,264 - 5,020,375 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,018,264 - 5,020,150 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	7,091,280 - 7,093,208 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	3,862,654 - 3,864,441 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	3,862,880 - 3,864,623 (+)	NCBI
Celera	20	4,230,730 - 4,232,517 (-)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

SAPCD1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,762,656 - 31,764,850 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,762,656 - 31,764,850 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	31,730,433 - 31,732,627 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,838,752 - 31,840,606 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	6	33,329,018 - 33,330,872 (+)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,517,201 - 31,519,056 (+)	NCBI		HuRef
CHM1_1	6	31,732,896 - 31,734,750 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,615,703 - 31,617,897 (+)	NCBI		T2T-CHM13v2.0

Sapcd1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,244,935 - 35,247,600 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,244,935 - 35,246,992 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	35,025,959 - 35,028,557 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,025,959 - 35,028,016 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	35,162,904 - 35,164,961 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,633,553 - 34,635,972 (-)	NCBI		MGSCv36	mm8
Celera	17	38,122,185 - 38,124,257 (-)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.56	NCBI

Sapcd1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	297,644 - 299,220 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	297,605 - 299,242 (+)	NCBI	ChiLan1.0	ChiLan1.0

SAPCD1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	46,239,423 - 46,241,581 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	42,201,545 - 42,203,085 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,423,704 - 31,425,719 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,311,318 - 32,313,411 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,311,318 - 32,313,406 (+)	Ensembl	panpan1.1		panPan2

SAPCD1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,243,489 - 1,245,476 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,243,974 - 1,245,429 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,380,013 - 1,382,521 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,386,741 - 1,389,249 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,387,226 - 1,388,682 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,245,965 - 1,248,472 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,313,127 - 1,315,635 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,381,060 - 1,383,565 (+)	NCBI		UU_Cfam_GSD_1.0

Sapcd1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,784,149 - 35,789,598 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,775,618 - 1,777,048 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936727	1,772,656 - 1,777,202 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SAPCD1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	40,258,684 - 40,261,092 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	40,259,121 - 40,260,597 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	31,675,242 - 31,677,350 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sapcd1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624754	24,452,429 - 24,453,725 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sapcd1
21 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	201
Count of miRNA genes:	142
Interacting mature miRNAs:	159
Transcripts:	ENSRNOT00000001146
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61472	Aia1	Adjuvant induced arthritis QTL 1	18	0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	2646395	4597031	Rat
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1527959	5304575	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
61448	Ciaa1	CIA Autoantibody QTL 1	30	0.001	blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	20	2646395	4597031	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
737973	Pia21	Pristane induced arthritis QTL 21	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	4606812	Rat

Markers in Region

BG372572

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,792,642 - 3,793,155 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	5,020,876 - 5,021,388	NCBI	Rnor6.0
Rnor_5.0	20	7,093,892 - 7,094,404	UniSTS	Rnor5.0
RGSC_v3.4	20	3,861,317 - 3,861,829	UniSTS	RGSC3.4
Celera	20	4,233,342 - 4,233,854	UniSTS
RH 3.4 Map	2	13.3	UniSTS
Cytogenetic Map	20	p12	UniSTS

RH129081

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,795,579 - 3,795,742 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	5,018,289 - 5,018,451	NCBI	Rnor6.0
Rnor_5.0	20	7,091,305 - 7,091,467	UniSTS	Rnor5.0
RGSC_v3.4	20	3,864,254 - 3,864,416	UniSTS	RGSC3.4
Celera	20	4,230,755 - 4,230,917	UniSTS
RH 3.4 Map	20	52.22	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	82	81	50	25	50	6	209	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001004069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006256068	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063279361	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001146 ⟹ ENSRNOP00000001146

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,793,967 - 3,795,790 (+)	Ensembl
Rnor_6.0 Ensembl	20	5,018,264 - 5,020,150 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000080415 ⟹ ENSRNOP00000073502

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	5,018,562 - 5,020,026 (-)	Ensembl

RefSeq Acc Id:

NM_001004069 ⟹ NP_001004069

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,798,635 - 3,800,422 (+)	NCBI
mRatBN7.2	20	3,793,980 - 3,795,767 (+)	NCBI
Rnor_6.0	20	5,018,264 - 5,020,051 (-)	NCBI
Rnor_5.0	20	7,091,280 - 7,093,208 (-)	NCBI
RGSC_v3.4	20	3,862,654 - 3,864,441 (+)	RGD
Celera	20	4,230,730 - 4,232,517 (-)	RGD

Sequence:

show sequence

GAGAGCCATGGAGAGCCCAGGTCCTGGTGAACTACCCCTGGTGCAAGCGCCCTACACTGTTCTG
CTGCTACCCCTGGGGACAAGCCATCAAGACCCAGGGGCCCAGAACTTCTTCCTCTGGCTGCAGA
TGATGCAGGCTCTGGAGAGGGAACAAGATGCTCTGTGGCAGGGCCTGGAGCTGCTGGAGCATAG
CCAAGCCTGGTTTGCAGACCGTCTGAGGGAAACACAGCAACGGCAGCTGCAGCTGGGGGCCCTT
GGTGAGGGCTTTCTGATGGACTCACACTCAGAGACCGCCACCCCTCAGCTAACCAGGATTCAAA
AGGTGAATGCTTGTTTGCGCAGTCTGATTCAGAAGGAGTTGTCAAAGCAGCAGAAAGGAGTCAG
CCATCGAACAGGAGAGGTGATCAGCCAGGCTCCCCCACCAGGAGCAAAGGGGCCTACCCTTGTG
TAAACCCTCCCCTCCCTGCACTGGTGTAAGGAGTGGGGTTGGAGTCAGAGTCCCCTGCCCCTGC
CCCTGCCCCCCTCATCTATTTAATCTTCATTCAGCAGCCAGTGGCTCCAGGCTGAGAAATTCAG
ACAACTCAGTAGAGTGCTCCTGCAACTCCTAAAAGTGTCCACCGCACTTCCTTGACATCCCTTG
CCCTCCCTCTCCCCCATGCCACTACAAAGCCCTGTCTTTCTTCAGTGTATTTGGGGAGGAGGCG
TGATCAAGGAGACTCTCCTTCAGCTTGAAGCAAAACTAAGCTAAAAAAGCTGCCCTGGAATTTA
AAGGAAAATTGTACTTTCTGGTGCCCCTGCCCTGCTCTGCTTCTGGAATAAACAGCAGCTCTCT
TAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063279360 ⟹ XP_063135430

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,798,124 - 3,800,141 (+)	NCBI

RefSeq Acc Id:

XM_063279361 ⟹ XP_063135431

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,798,601 - 3,800,106 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001004069	(Get FASTA)	NCBI Sequence Viewer
	XP_063135430	(Get FASTA)	NCBI Sequence Viewer
	XP_063135431	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAE83983	(Get FASTA)	NCBI Sequence Viewer
	EDL83488	(Get FASTA)	NCBI Sequence Viewer
	EDL83489	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000001146.3

RefSeq Acc Id:	NP_001004069 ⟸ NM_001004069
- UniProtKB:	Q6MG63 (UniProtKB/TrEMBL), A6KTQ9 (UniProtKB/TrEMBL), A6KTQ8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MESPGPGELPLVQAPYTVLLLPLGTSHQDPGAQNFFLWLQMMQALEREQDALWQGLELLEHSQA WFADRLRETQQRQLQLGALGEGFLMDSHSETATPQLTRIQKVNACLRSLIQKELSKQQKGVSHR TGEVISQAPPPGAKGPTLV hide sequence

Ensembl Acc Id:

ENSRNOP00000073502 ⟸ ENSRNOT00000080415

Ensembl Acc Id:

ENSRNOP00000001146 ⟸ ENSRNOT00000001146

RefSeq Acc Id:	XP_063135430 ⟸ XM_063279360
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_063135431 ⟸ XM_063279361
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6MG63-F1-model_v2	AlphaFold	Q6MG63	1-147	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701389

Promoter ID:

EPDNEW_R11906

Type:

multiple initiation site

Name:

Sapcd1_1

Description:

suppressor APC domain containing 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	5,020,062 - 5,020,122	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1359359	AgrOrtholog
BioCyc Gene	G2FUF-4631	BioCyc
Ensembl Genes	ENSRNOG00000000858	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000001146.7	UniProtKB/TrEMBL
InterPro	Suppressor_APCD_1/2	UniProtKB/TrEMBL
KEGG Report	rno:406170	UniProtKB/TrEMBL
NCBI Gene	406170	ENTREZGENE
PANTHER	PTHR14907	UniProtKB/TrEMBL
	SUPPRESSOR APC DOMAIN-CONTAINING PROTEIN 1	UniProtKB/TrEMBL
Pfam	Suppressor_APC	UniProtKB/TrEMBL
PhenoGen	Sapcd1	PhenoGen
RatGTEx	ENSRNOG00000000858	RatGTEx
UniProt	A6KTQ8	ENTREZGENE, UniProtKB/TrEMBL
	A6KTQ9	ENTREZGENE, UniProtKB/TrEMBL
	Q6MG63	ENTREZGENE
UniProt Secondary	Q6MG63	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-10-05	Sapcd1	suppressor APC domain containing 1	Ng23	Ng23 protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ng23	Ng23 protein			Symbol and Name updated	1559027	APPROVED
2005-07-29	Ng23	Ng23 protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar