Symbol:
Klf2
Name:
KLF transcription factor 2
RGD ID:
1359220
Description:
Predicted to enable DNA-binding transcription factor activity, RNA polymerase II-specific and RNA polymerase II cis-regulatory region sequence-specific DNA binding activity. Involved in several processes, including cellular response to cytokine stimulus; cellular response to endothelin; and regulation of gene expression. Predicted to be located in chromatin and nucleus. Orthologous to human KLF2 (KLF transcription factor 2); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Krueppel-like factor 2; Kruppel-like factor; Kruppel-like factor 2; Kruppel-like factor 2 (lung); Lklf; lung krueppel-like factor; lung Kruppel-like factor
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 17,555,136 - 17,557,768 (-) NCBI GRCr8 mRatBN7.2 16 17,521,107 - 17,523,739 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 17,514,552 - 17,523,944 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 17,587,223 - 17,589,173 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 18,720,530 - 18,722,483 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 17,640,143 - 17,642,093 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 19,223,087 - 19,225,037 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 19,223,087 - 19,225,037 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 19,084,196 - 19,086,146 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 17,941,780 - 17,943,730 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 17,941,777 - 17,943,728 (-) NCBI Celera 16 17,739,313 - 17,741,263 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Klf2 Rat 1,2-dimethylhydrazine multiple interactions ISO Klf2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KLF2 mRNA CTD PMID:22206623 Klf2 Rat 17alpha-ethynylestradiol multiple interactions ISO Klf2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KLF2 mRNA CTD PMID:17942748 Klf2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of KLF2 mRNA CTD PMID:17108234 Klf2 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of KLF2 mRNA CTD PMID:32145629 Klf2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Klf2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of KLF2 mRNA CTD PMID:17337447 more ... Klf2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of KLF2 mRNA CTD PMID:32109520 and PMID:33387578 Klf2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Klf2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of KLF2 mRNA CTD PMID:21570461 and PMID:24680724 Klf2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of KLF2 mRNA CTD PMID:23238561 Klf2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Klf2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of KLF2 mRNA CTD PMID:20159946 Klf2 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Klf2 (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of KLF2 mRNA and AHR protein affects the reaction [Tetrachlorodibenzodioxin results in increased expression of KLF2 mRNA] CTD PMID:17337447 and PMID:17942748 Klf2 Rat 2-butoxyethanol decreases expression ISO Klf2 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of KLF2 mRNA CTD PMID:19812364 Klf2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Klf2 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of KLF2 mRNA CTD PMID:25172293 Klf2 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Klf2 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of KLF2 mRNA CTD PMID:20188158 Klf2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO Klf2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of KLF2 mRNA and silybin inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of KLF2 mRNA] CTD PMID:25559859 Klf2 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO KLF2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of KLF2 mRNA CTD PMID:28628672 Klf2 Rat 3-methylcholanthrene increases expression ISO Klf2 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of KLF2 mRNA CTD PMID:20713471 Klf2 Rat 4,4'-diaminodiphenylmethane increases expression ISO Klf2 (Mus musculus) 6480464 4 and 4'-diaminodiphenylmethane results in increased expression of KLF2 mRNA CTD PMID:18648102 Klf2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Klf2 (Mus musculus) 6480464 bisphenol S affects the methylation of KLF2 gene CTD PMID:31683443 Klf2 Rat 4-aminobenzohydrazide multiple interactions ISO KLF2 (Homo sapiens) 6480464 4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in increased expression of KLF2 mRNA] CTD PMID:24530881 Klf2 Rat 4-hydroxyphenyl retinamide increases expression ISO Klf2 (Mus musculus) 6480464 Fenretinide results in increased expression of KLF2 mRNA CTD PMID:28973697 Klf2 Rat 4-nitrophenol decreases expression ISO Klf2 (Mus musculus) 6480464 4-nitrophenol results in decreased expression of KLF2 mRNA CTD PMID:34673133 Klf2 Rat 5-aza-2'-deoxycytidine affects expression ISO KLF2 (Homo sapiens) 6480464 Decitabine affects the expression of KLF2 mRNA CTD PMID:23300844 Klf2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of KLF2 mRNA CTD PMID:31881176 Klf2 Rat adenine decreases expression ISO Klf2 (Mus musculus) 6480464 Adenine results in decreased expression of KLF2 protein CTD PMID:35635602 Klf2 Rat adenine multiple interactions ISO Klf2 (Mus musculus) 6480464 [Cinacalcet inhibits the reaction [Adenine results in increased expression of TRAF2 protein]] which results in decreased ubiquitination of and results in decreased degradation of KLF2 protein more ... CTD PMID:35635602 Klf2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of KLF2 mRNA CTD PMID:16483693 Klf2 Rat arsane multiple interactions ISO KLF2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLF2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KLF2 mRNA CTD PMID:32525701 and PMID:39836092 Klf2 Rat arsenic atom multiple interactions ISO KLF2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLF2 mRNA and [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KLF2 mRNA CTD PMID:32525701 and PMID:39836092 Klf2 Rat arsenite(3-) decreases expression ISO Klf2 (Mus musculus) 6480464 arsenite results in decreased expression of KLF2 mRNA CTD PMID:15894712 Klf2 Rat arsenite(3-) multiple interactions ISO Klf2 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of KLF2 mRNA CTD PMID:15894712 Klf2 Rat arsenous acid decreases expression ISO KLF2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of KLF2 mRNA CTD PMID:26705709 Klf2 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of KLF2 mRNA CTD PMID:33854195 Klf2 Rat baicalein increases expression ISO Klf2 (Mus musculus) 6480464 baicalein results in increased expression of KLF2 mRNA CTD PMID:24560969 Klf2 Rat benzalkonium chloride increases expression ISO KLF2 (Homo sapiens) 6480464 Benzalkonium Compounds results in increased expression of KLF2 mRNA CTD PMID:37149095 Klf2 Rat benzene decreases expression ISO KLF2 (Homo sapiens) 6480464 Benzene results in decreased expression of KLF2 mRNA CTD PMID:19162166 Klf2 Rat benzene-1,2,4-triol multiple interactions ISO KLF2 (Homo sapiens) 6480464 4-aminobenzhydrazide inhibits the reaction [hydroxyhydroquinone results in increased expression of KLF2 mRNA] CTD PMID:24530881 Klf2 Rat benzene-1,2,4-triol increases expression ISO KLF2 (Homo sapiens) 6480464 hydroxyhydroquinone results in increased expression of KLF2 mRNA CTD PMID:24530881 Klf2 Rat benzo[a]pyrene multiple interactions ISO Klf2 (Mus musculus) 6480464 [arsenite co-treated with Benzo(a)pyrene] results in decreased expression of KLF2 mRNA CTD PMID:15894712 Klf2 Rat benzo[a]pyrene decreases methylation ISO KLF2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of KLF2 promoter CTD PMID:27901495 Klf2 Rat benzo[a]pyrene increases expression ISO Klf2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of KLF2 mRNA CTD PMID:20713471 more ... Klf2 Rat benzo[a]pyrene decreases expression ISO Klf2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of KLF2 mRNA CTD PMID:15894712 Klf2 Rat benzo[a]pyrene diol epoxide I decreases expression ISO KLF2 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Klf2 Rat Benzo[k]fluoranthene increases expression ISO Klf2 (Mus musculus) 6480464 benzo(k)fluoranthene results in increased expression of KLF2 mRNA CTD PMID:26377693 Klf2 Rat beta-naphthoflavone increases expression ISO KLF2 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of KLF2 mRNA CTD PMID:32858204 Klf2 Rat bis(2-ethylhexyl) phthalate increases expression ISO Klf2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of KLF2 mRNA CTD PMID:33754040 Klf2 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of KLF2 mRNA CTD PMID:25181051 Klf2 Rat bisphenol A increases expression ISO Klf2 (Mus musculus) 6480464 bisphenol A results in increased expression of KLF2 mRNA CTD PMID:32156529 Klf2 Rat bisphenol A decreases expression ISO KLF2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of KLF2 mRNA CTD PMID:31536135 Klf2 Rat bisphenol A increases expression ISO KLF2 (Homo sapiens) 6480464 bisphenol A results in increased expression of KLF2 mRNA CTD PMID:27685785 Klf2 Rat bisphenol F increases expression ISO KLF2 (Homo sapiens) 6480464 bisphenol F results in increased expression of KLF2 mRNA CTD PMID:33476716 Klf2 Rat bisphenol F affects expression ISO Klf2 (Mus musculus) 6480464 bisphenol F affects the expression of KLF2 mRNA CTD PMID:38685157 Klf2 Rat bisphenol F multiple interactions ISO KLF2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of KLF2 mRNA CTD PMID:28628672 Klf2 Rat buta-1,3-diene decreases expression ISO Klf2 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of KLF2 mRNA CTD PMID:29038090 Klf2 Rat cadmium dichloride multiple interactions EXP 6480464 [Cadmium Chloride co-treated with diallyl disulfide] results in increased expression of KLF2 mRNA CTD PMID:31077537 Klf2 Rat cadmium dichloride increases expression ISO KLF2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of KLF2 mRNA CTD PMID:38382870 Klf2 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of KLF2 mRNA CTD PMID:31077537 Klf2 Rat captan decreases expression ISO Klf2 (Mus musculus) 6480464 Captan results in decreased expression of KLF2 mRNA CTD PMID:31558096 Klf2 Rat carbamazepine affects expression ISO KLF2 (Homo sapiens) 6480464 Carbamazepine affects the expression of KLF2 mRNA CTD PMID:25979313 Klf2 Rat carbon nanotube decreases expression ISO Klf2 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Klf2 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of KLF2 mRNA CTD PMID:33854195 Klf2 Rat chlorpyrifos increases expression ISO Klf2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of KLF2 mRNA CTD PMID:37019170 Klf2 Rat chromium(6+) multiple interactions ISO KLF2 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in decreased expression of KLF2 mRNA CTD PMID:38479592 Klf2 Rat ciguatoxin CTX1B affects expression ISO Klf2 (Mus musculus) 6480464 Ciguatoxins affects the expression of KLF2 mRNA CTD PMID:18353800 Klf2 Rat cinacalcet multiple interactions ISO Klf2 (Mus musculus) 6480464 [Cinacalcet inhibits the reaction [Adenine results in increased expression of TRAF2 protein]] which results in decreased ubiquitination of and results in decreased degradation of KLF2 protein more ... CTD PMID:35635602 Klf2 Rat cinacalcet increases expression ISO Klf2 (Mus musculus) 6480464 Cinacalcet results in increased expression of KLF2 protein CTD PMID:35635602 Klf2 Rat cinacalcet decreases ubiquitination ISO Klf2 (Mus musculus) 6480464 Cinacalcet results in decreased ubiquitination of KLF2 protein CTD PMID:35635602 Klf2 Rat cisplatin affects response to substance ISO KLF2 (Homo sapiens) 6480464 KLF2 protein affects the susceptibility to Cisplatin CTD PMID:16217747 Klf2 Rat cisplatin multiple interactions ISO KLF2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of KLF2 mRNA CTD PMID:27392435 Klf2 Rat cisplatin decreases expression ISO KLF2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of KLF2 mRNA CTD PMID:27392435 Klf2 Rat cisplatin affects expression ISO KLF2 (Homo sapiens) 6480464 Cisplatin affects the expression of KLF2 mRNA CTD PMID:23300844 Klf2 Rat clofibrate decreases expression ISO Klf2 (Mus musculus) 6480464 Clofibrate results in decreased expression of KLF2 mRNA CTD PMID:17585979 Klf2 Rat copper(II) sulfate increases expression ISO KLF2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of KLF2 mRNA CTD PMID:19549813 Klf2 Rat corn oil affects expression EXP 6480464 Corn Oil affects the expression of KLF2 mRNA CTD PMID:16360708 Klf2 Rat coumarin decreases expression EXP 6480464 coumarin results in decreased expression of KLF2 mRNA CTD PMID:18480146 Klf2 Rat cyclophosphamide increases expression ISO Klf2 (Mus musculus) 6480464 Cyclophosphamide results in increased expression of KLF2 mRNA CTD PMID:21041162 Klf2 Rat cyclosporin A increases expression ISO Klf2 (Mus musculus) 6480464 Cyclosporine results in increased expression of KLF2 mRNA CTD PMID:19770486 Klf2 Rat cyclosporin A increases expression ISO KLF2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of KLF2 mRNA CTD PMID:20106945 more ... Klf2 Rat cypermethrin decreases expression ISO KLF2 (Homo sapiens) 6480464 cypermethrin results in decreased expression of KLF2 mRNA CTD PMID:25424538 Klf2 Rat decabromodiphenyl ether decreases expression EXP 6480464 decabromobiphenyl ether results in decreased expression of KLF2 mRNA CTD PMID:23914054 Klf2 Rat dexamethasone increases expression ISO Klf2 (Mus musculus) 6480464 Dexamethasone results in increased expression of KLF2 mRNA CTD PMID:21041162 and PMID:22733784 Klf2 Rat dexamethasone multiple interactions ISO KLF2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of KLF2 mRNA CTD PMID:28628672 Klf2 Rat dexamethasone multiple interactions ISO Klf2 (Mus musculus) 6480464 [1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of KLF2 mRNA and Silybin inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of KLF2 mRNA] CTD PMID:25559859 Klf2 Rat diallyl disulfide increases expression EXP 6480464 diallyl disulfide results in increased expression of KLF2 mRNA CTD PMID:31077537 Klf2 Rat diallyl disulfide multiple interactions EXP 6480464 [Cadmium Chloride co-treated with diallyl disulfide] results in increased expression of KLF2 mRNA CTD PMID:31077537 Klf2 Rat diarsenic trioxide decreases expression ISO KLF2 (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of KLF2 mRNA CTD PMID:26705709 Klf2 Rat diethylstilbestrol increases expression ISO Klf2 (Mus musculus) 6480464 Diethylstilbestrol results in increased expression of KLF2 mRNA CTD PMID:21041162 Klf2 Rat dimethyl sulfoxide increases expression EXP 6480464 Dimethyl Sulfoxide results in increased expression of KLF2 mRNA CTD PMID:22193206 Klf2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of KLF2 mRNA CTD PMID:25152437 Klf2 Rat dorsomorphin decreases expression ISO KLF2 (Homo sapiens) 6480464 dorsomorphin results in decreased expression of KLF2 mRNA CTD PMID:19815564 Klf2 Rat doxorubicin increases expression ISO KLF2 (Homo sapiens) 6480464 Doxorubicin results in increased expression of KLF2 mRNA CTD PMID:18510171 Klf2 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of KLF2 mRNA CTD PMID:29391264 Klf2 Rat ethyl 3,4-dihydroxybenzoate multiple interactions ISO Klf2 (Mus musculus) 6480464 ethyl protocatechuate inhibits the reaction [rosiglitazone results in increased ubiquitination of and results in increased degradation of KLF2 protein] CTD PMID:24338020 Klf2 Rat ferric oxide decreases expression ISO Klf2 (Mus musculus) 6480464 ferric oxide analog results in decreased expression of KLF2 mRNA CTD PMID:25086211 Klf2 Rat folic acid multiple interactions ISO Klf2 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of KLF2 mRNA CTD PMID:22206623 Klf2 Rat folpet decreases expression ISO Klf2 (Mus musculus) 6480464 folpet results in decreased expression of KLF2 mRNA CTD PMID:31558096 Klf2 Rat formaldehyde increases expression ISO KLF2 (Homo sapiens) 6480464 Formaldehyde results in increased expression of KLF2 mRNA CTD PMID:23416264 Klf2 Rat Genipin multiple interactions ISO Klf2 (Mus musculus) 6480464 genipin inhibits the reaction [Lipopolysaccharides results in increased expression of KLF2 mRNA] CTD PMID:22687549 Klf2 Rat gentamycin increases expression EXP 6480464 Gentamicins results in increased expression of KLF2 mRNA CTD PMID:33387578 Klf2 Rat glycidol decreases expression EXP 6480464 glycidol results in decreased expression of KLF2 mRNA CTD PMID:24915197 Klf2 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of KLF2 mRNA CTD PMID:33854195 Klf2 Rat hexanal affects expression EXP 6480464 n-hexanal affects the expression of KLF2 mRNA CTD PMID:26880647 Klf2 Rat hydroquinone increases expression ISO KLF2 (Homo sapiens) 6480464 hydroquinone results in increased expression of KLF2 mRNA CTD PMID:31256213 Klf2 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of KLF2 mRNA CTD PMID:33854195 Klf2 Rat indometacin multiple interactions ISO KLF2 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol F] results in increased expression of KLF2 mRNA CTD PMID:28628672 Klf2 Rat Licochalcone B increases expression ISO KLF2 (Homo sapiens) 6480464 licochalcone B results in increased expression of KLF2 mRNA CTD PMID:33647349 Klf2 Rat lipopolysaccharide multiple interactions ISO Klf2 (Mus musculus) 6480464 genipin inhibits the reaction [Lipopolysaccharides results in increased expression of KLF2 mRNA] CTD PMID:22687549 Klf2 Rat lipopolysaccharide increases expression ISO Klf2 (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of KLF2 mRNA CTD PMID:22687549 Klf2 Rat maneb multiple interactions ISO Klf2 (Mus musculus) 6480464 [Paraquat co-treated with Maneb] affects the expression of KLF2 mRNA CTD PMID:22563483 Klf2 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of KLF2 mRNA CTD PMID:28801915 Klf2 Rat mercury atom decreases expression ISO KLF2 (Homo sapiens) 6480464 Mercury results in decreased expression of KLF2 mRNA CTD PMID:19937285 Klf2 Rat mercury(0) decreases expression ISO KLF2 (Homo sapiens) 6480464 Mercury results in decreased expression of KLF2 mRNA CTD PMID:19937285 Klf2 Rat methotrexate decreases expression ISO KLF2 (Homo sapiens) 6480464 Methotrexate results in decreased expression of KLF2 mRNA CTD PMID:17400583 Klf2 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of KLF2 gene CTD PMID:35440735 Klf2 Rat mevalonic acid multiple interactions ISO KLF2 (Homo sapiens) 6480464 Mevalonic Acid inhibits the reaction [Simvastatin results in increased expression of KLF2 mRNA] CTD PMID:20493886 Klf2 Rat N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal multiple interactions ISO Klf2 (Mus musculus) 6480464 benzyloxycarbonylleucyl-leucyl-leucine aldehyde inhibits the reaction [TRAF2 protein results in decreased expression of KLF2 protein] CTD PMID:35635602 Klf2 Rat neomycin increases expression ISO Klf2 (Mus musculus) 6480464 Neomycin results in increased expression of KLF2 mRNA CTD PMID:30626089 Klf2 Rat nitrates multiple interactions ISO Klf2 (Mus musculus) 6480464 [Particulate Matter results in increased abundance of Nitrates] which results in increased expression of KLF2 mRNA CTD PMID:35964746 Klf2 Rat nitrofen decreases expression EXP 6480464 nitrofen results in decreased expression of KLF2 mRNA CTD PMID:21053160 Klf2 Rat ochratoxin A decreases expression ISO KLF2 (Homo sapiens) 6480464 ochratoxin A results in decreased expression of KLF2 mRNA CTD PMID:24356939 Klf2 Rat okadaic acid increases expression ISO KLF2 (Homo sapiens) 6480464 Okadaic Acid results in increased expression of KLF2 mRNA CTD PMID:38832940 Klf2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of KLF2 mRNA CTD PMID:25729387 Klf2 Rat oxybenzone decreases expression ISO Klf2 (Mus musculus) 6480464 oxybenzone results in decreased expression of KLF2 mRNA CTD PMID:39343157 Klf2 Rat ozone decreases expression EXP 6480464 Ozone results in decreased expression of KLF2 mRNA CTD PMID:28549673 Klf2 Rat ozone multiple interactions ISO KLF2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of KLF2 mRNA CTD PMID:35430440 Klf2 Rat ozone multiple interactions ISO Klf2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of KLF2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of KLF2 mRNA CTD PMID:27106289 and PMID:34911549 Klf2 Rat paracetamol affects expression ISO Klf2 (Mus musculus) 6480464 Acetaminophen affects the expression of KLF2 mRNA CTD PMID:17562736 Klf2 Rat paracetamol increases expression EXP 6480464 Acetaminophen results in increased expression of KLF2 mRNA CTD PMID:33387578 Klf2 Rat paracetamol increases expression ISO KLF2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of KLF2 mRNA CTD PMID:21420995 and PMID:29067470 Klf2 Rat paraquat multiple interactions ISO Klf2 (Mus musculus) 6480464 [Paraquat co-treated with Maneb] affects the expression of KLF2 mRNA CTD PMID:22563483 Klf2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of KLF2 mRNA and Paraquat results in decreased expression of KLF2 protein CTD PMID:26813466 Klf2 Rat paraquat decreases expression ISO Klf2 (Mus musculus) 6480464 Paraquat results in decreased expression of KLF2 mRNA CTD PMID:22563483 Klf2 Rat phenytoin increases expression EXP 6480464 Phenytoin results in increased expression of KLF2 mRNA CTD PMID:20345932 Klf2 Rat pioglitazone multiple interactions ISO KLF2 (Homo sapiens) 6480464 [pioglitazone co-treated with tert-Butylhydroperoxide] results in increased expression of KLF2 mRNA and pioglitazone inhibits the reaction [tert-Butylhydroperoxide results in increased expression of KLF2 mRNA] CTD PMID:20847119 Klf2 Rat pirinixic acid increases expression ISO Klf2 (Mus musculus) 6480464 pirinixic acid results in increased expression of KLF2 mRNA CTD PMID:18445702 Klf2 Rat platycodin D increases expression ISO Klf2 (Mus musculus) 6480464 platycodin D results in increased expression of KLF2 mRNA CTD PMID:20024897 Klf2 Rat platycodin D multiple interactions ISO Klf2 (Mus musculus) 6480464 KLF2 affects the reaction [platycodin D results in decreased activity of PPARG protein] and KLF2 affects the reaction [platycodin D results in decreased expression of PPARG mRNA] CTD PMID:20024897 Klf2 Rat propanal decreases expression ISO KLF2 (Homo sapiens) 6480464 propionaldehyde results in decreased expression of KLF2 mRNA CTD PMID:26079696 Klf2 Rat pterostilbene increases expression ISO KLF2 (Homo sapiens) 6480464 pterostilbene results in increased expression of KLF2 mRNA and pterostilbene results in increased expression of KLF2 protein CTD PMID:26443543 Klf2 Rat pterostilbene multiple interactions ISO KLF2 (Homo sapiens) 6480464 MAPK7 protein affects the reaction [pterostilbene results in increased expression of KLF2 mRNA] and pterostilbene promotes the reaction [KLF2 protein binds to SOD2 promoter] CTD PMID:26443543 Klf2 Rat pyridaben decreases expression ISO Klf2 (Mus musculus) 6480464 pyridaben results in decreased expression of KLF2 mRNA CTD PMID:22563483 Klf2 Rat resveratrol multiple interactions ISO KLF2 (Homo sapiens) 6480464 KLF2 protein promotes the reaction [resveratrol results in increased expression of NOS3 mRNA] more ... CTD PMID:19815564 and PMID:26443543 Klf2 Rat resveratrol multiple interactions ISO Klf2 (Mus musculus) 6480464 [Dietary Fats co-treated with Resveratrol] results in increased expression of KLF2 mRNA CTD PMID:29197120 Klf2 Rat resveratrol increases expression ISO KLF2 (Homo sapiens) 6480464 resveratrol results in increased expression of KLF2 mRNA and resveratrol results in increased expression of KLF2 protein CTD PMID:19815564 and PMID:26443543 Klf2 Rat resveratrol increases expression ISO Klf2 (Mus musculus) 6480464 resveratrol results in increased expression of KLF2 mRNA CTD PMID:25338179 Klf2 Rat rifampicin multiple interactions ISO KLF2 (Homo sapiens) 6480464 [Rifampin co-treated with NR1I2 protein] results in increased expression of KLF2 mRNA CTD PMID:21127053 Klf2 Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of KLF2 mRNA CTD PMID:27979718 Klf2 Rat scopolamine decreases expression EXP 6480464 Scopolamine results in decreased expression of KLF2 mRNA CTD PMID:17540011 Klf2 Rat silibinin multiple interactions ISO Klf2 (Mus musculus) 6480464 Silybin inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of KLF2 mRNA] CTD PMID:25559859 Klf2 Rat silicon dioxide increases expression ISO Klf2 (Mus musculus) 6480464 Silicon Dioxide results in increased expression of KLF2 mRNA CTD PMID:19073995 and PMID:33720480 Klf2 Rat silicon dioxide decreases expression ISO KLF2 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of KLF2 mRNA CTD PMID:23806026 Klf2 Rat simvastatin increases expression ISO KLF2 (Homo sapiens) 6480464 Simvastatin results in increased expression of KLF2 mRNA CTD PMID:17428261 more ... Klf2 Rat simvastatin decreases expression EXP 6480464 Simvastatin results in decreased expression of KLF2 mRNA CTD PMID:22305382 Klf2 Rat simvastatin multiple interactions ISO KLF2 (Homo sapiens) 6480464 Mevalonic Acid inhibits the reaction [Simvastatin results in increased expression of KLF2 mRNA] CTD PMID:20493886 Klf2 Rat sirolimus increases expression ISO KLF2 (Homo sapiens) 6480464 Sirolimus results in increased expression of KLF2 mRNA CTD PMID:24356939 Klf2 Rat sirtinol multiple interactions ISO KLF2 (Homo sapiens) 6480464 sirtinol inhibits the reaction [resveratrol results in increased expression of KLF2 mRNA] CTD PMID:19815564 Klf2 Rat sodium arsenate decreases expression ISO Klf2 (Mus musculus) 6480464 sodium arsenate results in decreased expression of KLF2 mRNA CTD PMID:21795629 Klf2 Rat sodium arsenate multiple interactions ISO KLF2 (Homo sapiens) 6480464 [sodium arsenate results in increased abundance of Arsenic] which results in decreased expression of KLF2 mRNA CTD PMID:32525701 Klf2 Rat sodium arsenite decreases expression ISO Klf2 (Mus musculus) 6480464 sodium arsenite results in decreased expression of KLF2 mRNA CTD PMID:16014739 more ... Klf2 Rat sodium arsenite multiple interactions ISO KLF2 (Homo sapiens) 6480464 [sodium arsenite results in increased abundance of Arsenic] which results in decreased expression of KLF2 mRNA CTD PMID:39836092 Klf2 Rat sodium arsenite increases expression ISO KLF2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of KLF2 mRNA CTD PMID:38568856 Klf2 Rat sodium arsenite decreases expression ISO KLF2 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of KLF2 mRNA CTD PMID:20371982 and PMID:38568856 Klf2 Rat sodium dichromate decreases expression ISO Klf2 (Mus musculus) 6480464 sodium bichromate results in decreased expression of KLF2 mRNA CTD PMID:31558096 Klf2 Rat sulfur dioxide multiple interactions ISO KLF2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Sulfur Dioxide] which results in decreased expression of KLF2 mRNA CTD PMID:32248990 Klf2 Rat sunitinib increases expression ISO KLF2 (Homo sapiens) 6480464 Sunitinib results in increased expression of KLF2 mRNA CTD PMID:31533062 Klf2 Rat tert-butyl hydroperoxide multiple interactions ISO KLF2 (Homo sapiens) 6480464 [pioglitazone co-treated with tert-Butylhydroperoxide] results in increased expression of KLF2 mRNA more ... CTD PMID:20847119 Klf2 Rat tert-butyl hydroperoxide increases expression ISO KLF2 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of KLF2 mRNA CTD PMID:20847119 Klf2 Rat tetrachloromethane affects expression ISO Klf2 (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of KLF2 mRNA CTD PMID:17484886 Klf2 Rat tetrachloromethane increases expression ISO Klf2 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of KLF2 mRNA CTD PMID:31919559 Klf2 Rat tetrathiomolybdate(2-) decreases expression ISO KLF2 (Homo sapiens) 6480464 tetrathiomolybdate analog results in decreased expression of KLF2 mRNA CTD PMID:19323979 Klf2 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in decreased expression of KLF2 mRNA CTD PMID:33854195 Klf2 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of KLF2 mRNA CTD PMID:34492290 Klf2 Rat titanium dioxide decreases expression ISO Klf2 (Mus musculus) 6480464 titanium dioxide results in decreased expression of KLF2 mRNA CTD PMID:23557971 and PMID:29264374 Klf2 Rat titanium dioxide decreases expression ISO KLF2 (Homo sapiens) 6480464 titanium dioxide results in decreased expression of KLF2 mRNA CTD PMID:34633093 Klf2 Rat titanium dioxide decreases methylation ISO Klf2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of KLF2 gene CTD PMID:35295148 Klf2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of KLF2 mRNA CTD PMID:25729387 Klf2 Rat torcetrapib increases expression ISO KLF2 (Homo sapiens) 6480464 torcetrapib results in increased expression of KLF2 mRNA CTD PMID:23228038 Klf2 Rat triadimefon decreases expression ISO KLF2 (Homo sapiens) 6480464 triadimefon results in decreased expression of KLF2 mRNA CTD PMID:26705709 Klf2 Rat tributylstannane increases expression ISO KLF2 (Homo sapiens) 6480464 tributyltin results in increased expression of KLF2 mRNA CTD PMID:24356939 Klf2 Rat Tributyltin oxide increases expression ISO KLF2 (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in increased expression of KLF2 mRNA CTD PMID:24356939 Klf2 Rat trichloroethene increases methylation EXP 6480464 Trichloroethylene results in increased methylation of KLF2 gene CTD PMID:27618143 Klf2 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of KLF2 mRNA CTD PMID:33387578 Klf2 Rat trichostatin A affects expression ISO KLF2 (Homo sapiens) 6480464 trichostatin A affects the expression of KLF2 mRNA CTD PMID:28542535 Klf2 Rat triphenyl phosphate affects expression ISO KLF2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of KLF2 mRNA CTD PMID:37042841 Klf2 Rat troglitazone multiple interactions ISO KLF2 (Homo sapiens) 6480464 troglitazone inhibits the reaction [tert-Butylhydroperoxide results in increased expression of KLF2 mRNA] CTD PMID:20847119 Klf2 Rat troglitazone decreases expression ISO Klf2 (Mus musculus) 6480464 troglitazone results in decreased expression of KLF2 mRNA CTD PMID:28973697 Klf2 Rat valproic acid increases methylation ISO KLF2 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of KLF2 gene CTD PMID:29154799 Klf2 Rat valproic acid increases expression ISO KLF2 (Homo sapiens) 6480464 Valproic Acid results in increased expression of KLF2 mRNA CTD PMID:28001369 Klf2 Rat valproic acid decreases methylation ISO KLF2 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of KLF2 gene CTD PMID:28853863 and PMID:29201983 Klf2 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of KLF2 mRNA CTD PMID:19015723 Klf2 Rat yoda 1 affects localization ISO KLF2 (Homo sapiens) 6480464 yoda-1 affects the localization of KLF2 protein CTD PMID:36214828 Klf2 Rat zinc atom multiple interactions ISO KLF2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KLF2 mRNA CTD PMID:18593933 Klf2 Rat zinc(0) multiple interactions ISO KLF2 (Homo sapiens) 6480464 [PCI 5002 co-treated with Zinc] results in increased expression of KLF2 mRNA CTD PMID:18593933
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-butoxyethanol (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 4,4'-diaminodiphenylmethane (ISO) 4,4'-sulfonyldiphenol (ISO) 4-aminobenzohydrazide (ISO) 4-hydroxyphenyl retinamide (ISO) 4-nitrophenol (ISO) 5-aza-2'-deoxycytidine (ISO) acetamide (EXP) adenine (ISO) ammonium chloride (EXP) arsane (ISO) arsenic atom (ISO) arsenite(3-) (ISO) arsenous acid (ISO) azoxystrobin (EXP) baicalein (ISO) benzalkonium chloride (ISO) benzene (ISO) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) Benzo[k]fluoranthene (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) buta-1,3-diene (ISO) cadmium dichloride (EXP,ISO) captan (ISO) carbamazepine (ISO) carbon nanotube (ISO) chlorpyrifos (EXP,ISO) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cinacalcet (ISO) cisplatin (ISO) clofibrate (ISO) copper(II) sulfate (ISO) corn oil (EXP) coumarin (EXP) cyclophosphamide (ISO) cyclosporin A (ISO) cypermethrin (ISO) decabromodiphenyl ether (EXP) dexamethasone (ISO) diallyl disulfide (EXP) diarsenic trioxide (ISO) diethylstilbestrol (ISO) dimethyl sulfoxide (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) ethyl 3,4-dihydroxybenzoate (ISO) ferric oxide (ISO) folic acid (ISO) folpet (ISO) formaldehyde (ISO) Genipin (ISO) gentamycin (EXP) glycidol (EXP) glyphosate (EXP) hexanal (EXP) hydroquinone (ISO) imidacloprid (EXP) indometacin (ISO) Licochalcone B (ISO) lipopolysaccharide (ISO) maneb (ISO) manganese(II) chloride (EXP) mercury atom (ISO) mercury(0) (ISO) methotrexate (ISO) methoxychlor (EXP) mevalonic acid (ISO) N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO) neomycin (ISO) nitrates (ISO) nitrofen (EXP) ochratoxin A (ISO) okadaic acid (ISO) oxaliplatin (EXP) oxybenzone (ISO) ozone (EXP,ISO) paracetamol (EXP,ISO) paraquat (EXP,ISO) phenytoin (EXP) pioglitazone (ISO) pirinixic acid (ISO) platycodin D (ISO) propanal (ISO) pterostilbene (ISO) pyridaben (ISO) resveratrol (ISO) rifampicin (ISO) rotenone (EXP) scopolamine (EXP) silibinin (ISO) silicon dioxide (ISO) simvastatin (EXP,ISO) sirolimus (ISO) sirtinol (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (ISO) sulfur dioxide (ISO) sunitinib (ISO) tert-butyl hydroperoxide (ISO) tetrachloromethane (ISO) tetrathiomolybdate(2-) (ISO) thiabendazole (EXP) thioacetamide (EXP) titanium dioxide (ISO) topotecan (EXP) torcetrapib (ISO) triadimefon (ISO) tributylstannane (ISO) Tributyltin oxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triphenyl phosphate (ISO) troglitazone (ISO) valproic acid (ISO) vinclozolin (EXP) yoda 1 (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
cell morphogenesis (IEA,ISO) cellular response to endothelin (IEP) cellular response to fluid shear stress (IEA,ISO) cellular response to hydrogen peroxide (IEP) cellular response to interleukin-1 (IEP) cellular response to laminar fluid shear stress (IEA,ISO) cellular response to tumor necrosis factor (IEP) cellular stress response to acid chemical (IEA,ISO) epigenetic regulation of gene expression (IEA,ISO) erythrocyte homeostasis (IEA,ISO) erythrocyte maturation (IEA,ISO) in utero embryonic development (IEA,ISO) multicellular organism growth (IEA,ISO) negative regulation of interleukin-6 production (IMP) negative regulation of sprouting angiogenesis (IEA,ISO) negative regulation of transcription by RNA polymerase II (IEA,ISO) positive regulation of DNA-templated transcription (IEA,IMP,ISO,ISS) positive regulation of nitric oxide biosynthetic process (IEA,ISO) positive regulation of protein metabolic process (IEA,ISO) positive regulation of retinoic acid receptor signaling pathway (IEA,ISO) positive regulation of transcription by RNA polymerase II (IEA,ISO) regulation of transcription by RNA polymerase II (IBA) response to laminar fluid shear stress (IEP) type I pneumocyte differentiation (IEA,ISO) vasodilation (IEA,ISO)
1.
Endothelin-1 regulation of immediate early gene expression in cardiac myocytes: negative feedback regulation of interleukin 6 by Atf3 and Klf2.
Clerk A, etal., Adv Enzyme Regul. 2009;49(1):30-42. Epub 2008 Dec 31.
2.
Differential regulation of Kruppel-like factor family transcription factor expression in neonatal rat cardiac myocytes: effects of endothelin-1, oxidative stress and cytokines.
Cullingford TE, etal., Biochim Biophys Acta. 2008 Jun;1783(6):1229-36. Epub 2008 Mar 25.
3.
T-cell survival regulator LKLF is not involved in inappropriate apoptosis of diabetes-prone BBDP rat T cells.
Diessenbacher P, etal., Ann N Y Acad Sci 2003 Dec;1010:548-51.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
6.
GOA pipeline
RGD automated data pipeline
7.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
8.
Shear stress regulation of Kruppel-like factor 2 expression is flow pattern-specific.
Wang N, etal., Biochem Biophys Res Commun. 2006 Mar 24;341(4):1244-51. Epub 2006 Jan 30.
9.
Lung Kruppel-like factor (LKLF) is a transcriptional activator of the cytosolic phospholipase A2 alpha promoter.
Wick MJ, etal., Biochem J. 2005 Apr 1;387(Pt 1):239-46.
Klf2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 16 17,555,136 - 17,557,768 (-) NCBI GRCr8 mRatBN7.2 16 17,521,107 - 17,523,739 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 16 17,514,552 - 17,523,944 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 16 17,587,223 - 17,589,173 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 16 18,720,530 - 18,722,483 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 16 17,640,143 - 17,642,093 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 16 19,223,087 - 19,225,037 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 16 19,223,087 - 19,225,037 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 16 19,084,196 - 19,086,146 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 16 17,941,780 - 17,943,730 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 16 17,941,777 - 17,943,728 (-) NCBI Celera 16 17,739,313 - 17,741,263 (-) NCBI Celera Cytogenetic Map 16 p14 NCBI
KLF2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 19 16,324,826 - 16,328,685 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 19 16,324,826 - 16,328,685 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 19 16,435,637 - 16,439,496 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 19 16,296,651 - 16,299,345 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 19 16,296,650 - 16,299,337 NCBI Celera 19 16,337,566 - 16,340,260 (+) NCBI Celera Cytogenetic Map 19 p13.11 NCBI HuRef 19 16,006,724 - 16,007,405 (+) NCBI HuRef CHM1_1 19 16,435,181 - 16,437,875 (+) NCBI CHM1_1 T2T-CHM13v2.0 19 16,459,702 - 16,463,562 (+) NCBI T2T-CHM13v2.0
Klf2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 8 73,072,906 - 73,075,498 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 8 73,072,877 - 73,075,500 (+) Ensembl GRCm39 Ensembl GRCm38 8 72,319,062 - 72,321,654 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 8 72,319,033 - 72,321,656 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 8 74,842,961 - 74,845,553 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 8 75,248,022 - 75,250,338 (+) NCBI MGSCv36 mm8 Celera 8 76,656,424 - 76,659,017 (+) NCBI Celera Cytogenetic Map 8 B3.3 NCBI cM Map 8 34.99 NCBI
KLF2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 20 21,194,451 - 21,197,283 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 19 20,200,667 - 20,203,238 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 19 15,812,506 - 15,815,244 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 19 16,792,497 - 16,794,143 (+) NCBI panpan1.1 PanPan1.1 panPan2
KLF2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 20 46,182,565 - 46,183,704 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 20 46,096,492 - 46,098,925 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 20 46,670,279 - 46,672,712 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 20 46,670,789 - 46,672,713 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 20 45,904,933 - 45,907,365 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 20 46,316,205 - 46,318,628 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 20 46,591,720 - 46,594,153 (-) NCBI UU_Cfam_GSD_1.0
KLF2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 61,270,199 - 61,273,138 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 61,270,733 - 61,273,037 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 60,903,997 - 60,904,625 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
KLF2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 6 14,832,013 - 14,834,744 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 6 14,832,029 - 14,837,462 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666074 4,637,274 - 4,640,383 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Klf2
.
Predicted Target Of
Count of predictions: 87 Count of miRNA genes: 75 Interacting mature miRNAs: 83 Transcripts: ENSRNOT00000019052 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
631561 Hcuc2 Hepatic copper content QTL 2 2.8 liver copper amount (VT:0003065) liver total copper weight (CMO:0001507) 16 1 39533949 Rat 1582235 Insul8 Insulin level QTL 8 3.3 0.0063 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 16 1 26727669 Rat 2307172 Activ4 Activity QTL 4 3.71 0.00023 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 16 1 33418960 Rat 1354584 Despr6 Despair related QTL 6 3.1 0.0067 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 39533930 Rat 2302380 Slep6 Serum leptin concentration QTL 6 3.36 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 1 32139025 Rat 737819 Hcas4 Hepatocarcinoma susceptibility QTL 4 4.43 liver integrity trait (VT:0010547) volume of individual liver tumorous lesion (CMO:0001078) 16 4227609 46975965 Rat 631517 Scl9 Serum cholesterol level QTL 9 3.3 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 16 15726433 21034895 Rat 9590151 Scort8 Serum corticosterone level QTL 8 8.45 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 16 1 30836262 Rat 1354625 Despr7 Despair related QTL 7 3.16 0.016 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 16 1 44977551 Rat 61338 Bp23 Blood pressure QTL 23 4.3 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 4227609 49227609 Rat 61405 Niddm6 Non-insulin dependent diabetes mellitus QTL 6 3.66 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 16 4227609 48972724 Rat 631830 Alc7 Alcohol consumption QTL 7 2.9 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 1 26727669 Rat 7411664 Foco30 Food consumption QTL 30 11 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 16 1 44588133 Rat 1600378 Arunc4 Aerobic running capacity QTL 4 0.03 exercise endurance trait (VT:0002332) maximum distance run on treadmill (CMO:0001406) 16 380245 80345693 Rat 70183 BpQTLcluster13 Blood pressure QTL cluster 13 3.654 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 16 4227609 43025077 Rat 1600369 Hcas8 Hepatocarcinoma susceptibility QTL 8 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 16 1 22477621 Rat 737826 Alc11 Alcohol consumption QTL 11 3.2 consumption behavior trait (VT:0002069) ethanol drink intake rate (CMO:0001407) 16 4227609 60252231 Rat 2303566 Bw90 Body weight QTL 90 2 body mass (VT:0001259) body weight (CMO:0000012) 16 1 39533930 Rat 2312663 Slep9 Serum leptin concentration QTL 9 0.001 blood leptin amount (VT:0005667) serum leptin level (CMO:0000780) 16 832236 59492508 Rat 2306902 Bp339 Blood pressure QTL 339 0.01 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 16 3380150 43025077 Rat 1300133 Rf24 Renal function QTL 24 3.64 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 16 3380150 21361552 Rat 2312660 Bw95 Body weight QTL 95 0.05 inguinal fat pad mass (VT:0010424) inguinal fat pad weight to body weight ratio (CMO:0001253) 16 832236 59492508 Rat 2312666 Insul16 Insulin level QTL 16 0.01 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 16 832236 59492508 Rat 634355 Rends4 Renal damage susceptibility QTL 4 0.05 kidney blood vessel morphology trait (VT:0000530) organ lesion measurement (CMO:0000677) 16 1 26727669 Rat 61372 Bp40 Blood pressure QTL 40 2.2 blood pressure trait (VT:0000183) systolic blood pressure (CMO:0000004) 16 4227730 17696785 Rat 2293343 Glom16 Glomerulus QTL 16 7.4 kidney glomerulus integrity trait (VT:0010546) kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269) 16 832236 46053497 Rat 6903319 Bw114 Body weight QTL 114 2.7 0.0037 body mass (VT:0001259) body weight (CMO:0000012) 16 1 43534949 Rat 2312669 Stl23 Serum triglyceride level QTL 23 0.01 blood triglyceride amount (VT:0002644) serum triglyceride level (CMO:0000360) 16 832236 59492508 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000019052 ⟹ ENSRNOP00000019052
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 16 19,223,087 - 19,225,037 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000112398 ⟹ ENSRNOP00000083422
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 16 17,514,552 - 17,523,944 (-) Ensembl
RefSeq Acc Id:
NM_001007684 ⟹ NP_001007685
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 16 17,555,136 - 17,557,768 (-) NCBI mRatBN7.2 16 17,521,107 - 17,523,739 (-) NCBI Rnor_6.0 16 19,223,087 - 19,225,037 (-) NCBI Rnor_5.0 16 19,084,196 - 19,086,146 (-) NCBI RGSC_v3.4 16 17,941,780 - 17,943,730 (-) RGD Celera 16 17,739,313 - 17,741,263 (-) RGD
Sequence:
ATGGCGCTCAGCGAGCCTATCTTGCCGTCCTTTGCCACTTTCGCCAGCCCCTGCGAGCGCGGCCTCCAGGAGCGCTGGCCGCGAAATGAGCCCGAGGCGGGCAGCACGGATGAGGACCTAAACAGCGT
hide sequence
RefSeq Acc Id:
NP_001007685 ⟸ NM_001007684
- UniProtKB:
Q9ET58 (UniProtKB/Swiss-Prot), A6K9P7 (UniProtKB/TrEMBL)
- Sequence:
MALSEPILPSFATFASPCERGLQERWPRNEPEAGSTDEDLNSVLDFILSMGLDGLGAENPPEPPPQPPPPAFYYPEPGAPPPYGTPAAGLGTELLRPDLDAPQGPALHGRFLLAPPGRLVKAEPPEVD
hide sequence
Ensembl Acc Id:
ENSRNOP00000019052 ⟸ ENSRNOT00000019052
Ensembl Acc Id:
ENSRNOP00000083422 ⟸ ENSRNOT00000112398
RGD ID: 13699986 Promoter ID: EPDNEW_R10508 Type: single initiation site Name: Klf2_1 Description: Kruppel-like factor 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 16 19,225,053 - 19,225,113 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2022-10-03
Klf2
KLF transcription factor 2
Klf2
Kruppel-like factor 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2013-11-11
Klf2
Kruppel-like factor 2
Klf2
Kruppel-like factor 2 (lung)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Klf2
Kruppel-like factor 2 (lung)
Klf2_predicted
Kruppel-like factor 2 (lung) (predicted)
'predicted' is removed
2292626 APPROVED
2006-03-30
Klf2_predicted
Kruppel-like factor 2 (lung) (predicted)
Klf2
Kruppel-like factor
Name updated
1299863 APPROVED
2005-12-06
Klf2
Kruppel-like factor
Symbol and Name updated
1559027 APPROVED
2005-07-29
Klf2
Kruppel-like factor
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_disease
is not mutated in the autoimmune IDDM-prone BB rat
1359759
gene_homology
inactivation of the mouse homolog causes development of autoimmune insulin dependent diabetes mellitus
1359759
