Symbol:
F12
Name:
coagulation factor XII
RGD ID:
1359175
Description:
Predicted to enable serine-type endopeptidase activity. Predicted to be involved in several processes, including positive regulation of plasminogen activation; protein maturation; and regulation of blood coagulation. Located in extracellular space. Used to study hyperhomocysteinemia. Human ortholog(s) of this gene implicated in angioedema (multiple); cerebrovascular disease (multiple); factor XII deficiency; and myocardial infarction. Orthologous to human F12 (coagulation factor XII); PARTICIPATES IN coagulation cascade pathway; acenocoumarol pharmacodynamics pathway; alteplase pharmacodynamics pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
coagulation factor XII (Hageman factor); factor XII; HAF; hageman factor; LOC306761; similar to coagulation factor XII (Hageman factor)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 9,212,819 - 9,220,664 (+) NCBI GRCr8 mRatBN7.2 17 9,207,683 - 9,215,530 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 9,207,683 - 9,215,530 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 9,223,730 - 9,231,646 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 10,753,767 - 10,761,675 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 9,220,120 - 9,228,036 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 9,736,577 - 9,744,420 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 9,736,577 - 9,744,420 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 11,845,561 - 11,853,600 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 15,251,611 - 15,259,583 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 15,251,610 - 15,259,583 (+) NCBI Celera 17 9,286,222 - 9,294,037 (+) NCBI Celera Cytogenetic Map 17 p14 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
F12 Rat (1->4)-beta-D-glucan multiple interactions ISO F12 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of F12 mRNA CTD PMID:36331819 F12 Rat 17beta-estradiol increases expression ISO F12 (Mus musculus) 6480464 Estradiol results in increased expression of F12 mRNA CTD PMID:39298647 F12 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO F12 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 F12 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO F12 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of F12 mRNA] CTD PMID:11007951 F12 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO F12 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of F12 mRNA CTD PMID:21570461 F12 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of F12 mRNA CTD PMID:21215274 F12 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO F12 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of F12 mRNA CTD PMID:11007951 F12 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO F12 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 F12 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of F12 mRNA CTD PMID:21346803 F12 Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of F12 mRNA CTD PMID:21346803 F12 Rat 4,4'-sulfonyldiphenol increases expression ISO F12 (Mus musculus) 6480464 bisphenol S results in increased expression of F12 mRNA CTD PMID:39298647 F12 Rat 4,4'-sulfonyldiphenol affects methylation ISO F12 (Mus musculus) 6480464 bisphenol S affects the methylation of F12 gene CTD PMID:31683443 F12 Rat 5-aza-2'-deoxycytidine affects expression ISO F12 (Homo sapiens) 6480464 Decitabine affects the expression of F12 mRNA CTD PMID:23300844 F12 Rat 5-fluorouracil affects response to substance ISO F12 (Homo sapiens) 6480464 F12 protein affects the susceptibility to Fluorouracil CTD PMID:15352031 F12 Rat 5-fluorouracil decreases expression ISO F12 (Homo sapiens) 6480464 Fluorouracil results in decreased expression of F12 protein CTD PMID:15352031 F12 Rat 6-propyl-2-thiouracil decreases expression EXP 6480464 Propylthiouracil results in decreased expression of F12 mRNA CTD PMID:24780913 F12 Rat acetamide decreases expression EXP 6480464 acetamide results in decreased expression of F12 mRNA CTD PMID:31881176 F12 Rat acrylamide increases expression EXP 6480464 Acrylamide results in increased expression of F12 mRNA CTD PMID:28959563 F12 Rat aflatoxin B1 affects expression ISO F12 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of F12 protein CTD PMID:20106945 F12 Rat aflatoxin B1 decreases expression ISO F12 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased expression of F12 mRNA CTD PMID:27153756 F12 Rat antirheumatic drug decreases expression ISO F12 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of F12 mRNA CTD PMID:24449571 F12 Rat arsenous acid decreases response to substance ISO F12 (Homo sapiens) 6480464 F12 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 F12 Rat benzo[a]pyrene increases expression ISO F12 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of F12 mRNA CTD PMID:20064835 F12 Rat benzo[a]pyrene decreases expression ISO F12 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of F12 mRNA CTD PMID:32234424 F12 Rat benzo[a]pyrene decreases methylation ISO F12 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of F12 exon CTD PMID:27901495 F12 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of F12 mRNA CTD PMID:25181051 F12 Rat bisphenol A increases expression ISO F12 (Mus musculus) 6480464 bisphenol A results in increased expression of F12 mRNA CTD PMID:30245210 F12 Rat bromobenzene increases expression EXP 6480464 bromobenzene results in increased expression of F12 mRNA CTD PMID:32479839 F12 Rat buta-1,3-diene decreases expression ISO F12 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of F12 mRNA CTD PMID:29038090 F12 Rat butanal increases expression ISO F12 (Homo sapiens) 6480464 butyraldehyde results in increased expression of F12 mRNA CTD PMID:26079696 F12 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of F12 mRNA CTD PMID:19167457 F12 Rat cadmium atom affects binding ISO F12 (Homo sapiens) 6480464 F12 protein binds to Cadmium CTD PMID:23896426 F12 Rat CGP 52608 multiple interactions ISO F12 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to F12 gene] CTD PMID:28238834 F12 Rat chondroitin sulfate increases activity ISO F12 (Homo sapiens) 6480464 Chondroitin Sulfates analog results in increased activity of F12 protein CTD PMID:18434646 F12 Rat cisplatin affects expression ISO F12 (Homo sapiens) 6480464 Cisplatin affects the expression of F12 mRNA CTD PMID:23300844 F12 Rat cisplatin increases expression ISO F12 (Mus musculus) 6480464 Cisplatin results in increased expression of F12 protein CTD PMID:31493026 F12 Rat clofibrate decreases expression ISO F12 (Mus musculus) 6480464 Clofibrate results in decreased expression of F12 mRNA CTD PMID:17585979 F12 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of F12 mRNA CTD PMID:24386269 F12 Rat copper atom multiple interactions ISO F12 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of F12 mRNA and [NSC 689534 binds to Copper] which results in decreased expression of F12 mRNA CTD PMID:20971185 and PMID:24690739 F12 Rat copper(0) multiple interactions ISO F12 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of F12 mRNA and [NSC 689534 binds to Copper] which results in decreased expression of F12 mRNA CTD PMID:20971185 and PMID:24690739 F12 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of F12 mRNA CTD PMID:26577399 F12 Rat cycloheximide multiple interactions ISO F12 (Homo sapiens) 6480464 Cycloheximide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of F12 mRNA] CTD PMID:11007951 F12 Rat cyclosporin A decreases expression ISO F12 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of F12 mRNA CTD PMID:20106945 more ... F12 Rat diarsenic trioxide decreases response to substance ISO F12 (Homo sapiens) 6480464 F12 protein results in decreased susceptibility to Arsenic Trioxide CTD PMID:20707922 F12 Rat disulfiram multiple interactions ISO F12 (Homo sapiens) 6480464 [Disulfiram binds to Copper] which results in decreased expression of F12 mRNA CTD PMID:24690739 F12 Rat dorsomorphin multiple interactions ISO F12 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of F12 mRNA CTD PMID:27188386 F12 Rat EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor decreases expression ISO F12 (Homo sapiens) 6480464 Angiotensin-Converting Enzyme Inhibitors results in decreased expression of F12 protein CTD PMID:6383834 F12 Rat ellagic acid multiple interactions ISO F12 (Homo sapiens) 6480464 ALB protein promotes the reaction [Ellagic Acid results in increased activity of F12 protein] CTD PMID:6343536 F12 Rat ellagic acid increases activity ISO F12 (Homo sapiens) 6480464 Ellagic Acid results in increased activity of F12 protein CTD PMID:6343536 F12 Rat entinostat increases expression ISO F12 (Homo sapiens) 6480464 entinostat results in increased expression of F12 mRNA CTD PMID:27188386 F12 Rat Ethyl icosapentate decreases activity EXP 6480464 eicosapentaenoic acid ethyl ester results in decreased activity of F12 protein CTD PMID:14614217 F12 Rat flutamide decreases expression EXP 6480464 Flutamide results in decreased expression of F12 mRNA CTD PMID:24136188 F12 Rat furan increases methylation EXP 6480464 furan results in increased methylation of F12 gene CTD PMID:22079235 F12 Rat furan decreases expression EXP 6480464 furan results in decreased expression of F12 mRNA CTD PMID:25539665 F12 Rat hydralazine multiple interactions ISO F12 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of F12 mRNA CTD PMID:17183730 F12 Rat isoflavones affects expression ISO F12 (Homo sapiens) 6480464 Isoflavones affects the expression of F12 mRNA CTD PMID:16365062 F12 Rat kaolin increases activity ISO F12 (Homo sapiens) 6480464 Kaolin results in increased activity of F12 protein CTD PMID:6343536 F12 Rat methotrexate affects response to substance ISO F12 (Homo sapiens) 6480464 F12 protein affects the susceptibility to Methotrexate CTD PMID:16217747 F12 Rat N-nitrosodiethylamine decreases expression EXP 6480464 Diethylnitrosamine results in decreased expression of F12 mRNA CTD PMID:19041683 F12 Rat N-Nitrosopyrrolidine decreases expression ISO F12 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in decreased expression of F12 mRNA CTD PMID:32234424 F12 Rat nickel atom affects binding ISO F12 (Homo sapiens) 6480464 F12 protein binds to Nickel CTD PMID:23896426 F12 Rat nickel atom increases expression ISO F12 (Homo sapiens) 6480464 Nickel results in increased expression of F12 mRNA CTD PMID:25583101 F12 Rat niclosamide increases expression ISO F12 (Homo sapiens) 6480464 Niclosamide results in increased expression of F12 mRNA CTD PMID:36318118 F12 Rat nitrofen increases expression EXP 6480464 nitrofen results in increased expression of F12 mRNA CTD PMID:33484710 F12 Rat O-methyleugenol decreases expression ISO F12 (Homo sapiens) 6480464 methyleugenol results in decreased expression of F12 mRNA CTD PMID:32234424 F12 Rat paracetamol decreases expression ISO F12 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of F12 mRNA CTD PMID:26690555 and PMID:29067470 F12 Rat parathion increases expression ISO F12 (Mus musculus) 6480464 Parathion results in increased expression of F12 mRNA CTD PMID:34813904 F12 Rat pentanal increases expression ISO F12 (Homo sapiens) 6480464 pentanal results in increased expression of F12 mRNA CTD PMID:26079696 F12 Rat perfluorooctane-1-sulfonic acid decreases expression ISO F12 (Mus musculus) 6480464 perfluorooctane sulfonic acid results in decreased expression of F12 mRNA CTD PMID:20936131 F12 Rat perfluorooctane-1-sulfonic acid multiple interactions ISO F12 (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in decreased expression of F12 mRNA CTD PMID:36331819 F12 Rat pirinixic acid decreases expression ISO F12 (Mus musculus) 6480464 pirinixic acid results in decreased expression of F12 mRNA CTD PMID:38810120 F12 Rat polyphosphates decreases response to substance ISO F12 (Mus musculus) 6480464 F12 gene mutant form results in decreased susceptibility to Polyphosphates CTD PMID:25339356 F12 Rat pregnenolone 16alpha-carbonitrile decreases expression ISO F12 (Mus musculus) 6480464 Pregnenolone Carbonitrile results in decreased expression of F12 mRNA CTD PMID:38810120 F12 Rat raloxifene increases activity ISO F12 (Homo sapiens) 6480464 Raloxifene Hydrochloride results in increased activity of F12 protein CTD PMID:16359964 F12 Rat sarin decreases expression ISO F12 (Homo sapiens) 6480464 Sarin results in decreased expression of F12 mRNA CTD PMID:19522546 F12 Rat SB 431542 multiple interactions ISO F12 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of F12 mRNA CTD PMID:27188386 F12 Rat sodium arsenite decreases expression ISO F12 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of F12 mRNA CTD PMID:29301061 and PMID:38568856 F12 Rat sodium arsenite affects expression ISO F12 (Homo sapiens) 6480464 sodium arsenite affects the expression of F12 mRNA CTD PMID:34032870 F12 Rat sulforaphane decreases expression ISO F12 (Homo sapiens) 6480464 sulforaphane results in decreased expression of F12 mRNA CTD PMID:31838189 F12 Rat testosterone decreases expression ISO F12 (Mus musculus) 6480464 Testosterone results in decreased expression of F12 mRNA CTD PMID:19693291 F12 Rat testosterone increases expression ISO F12 (Mus musculus) 6480464 Testosterone results in increased expression of F12 mRNA CTD PMID:19693291 F12 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of F12 mRNA CTD PMID:31150632 F12 Rat thimerosal decreases expression ISO F12 (Homo sapiens) 6480464 Thimerosal results in decreased expression of F12 mRNA CTD PMID:27188386 F12 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of F12 mRNA CTD PMID:23411599 and PMID:34492290 F12 Rat Tributyltin oxide increases expression ISO F12 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in increased expression of F12 mRNA CTD PMID:18958704 F12 Rat trichloroethene decreases expression EXP 6480464 Trichloroethylene results in decreased expression of F12 mRNA CTD PMID:33387578 F12 Rat triphenyl phosphate affects expression ISO F12 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of F12 mRNA CTD PMID:37042841 F12 Rat triptonide increases expression ISO F12 (Mus musculus) 6480464 triptonide results in increased expression of F12 mRNA CTD PMID:33045310 F12 Rat trovafloxacin increases expression ISO F12 (Mus musculus) 6480464 trovafloxacin results in increased expression of F12 mRNA CTD PMID:35537566 F12 Rat urethane decreases expression ISO F12 (Homo sapiens) 6480464 Urethane results in decreased expression of F12 mRNA CTD PMID:28818685 F12 Rat valproic acid multiple interactions ISO F12 (Homo sapiens) 6480464 [Hydralazine co-treated with Valproic Acid] results in increased expression of F12 mRNA more ... CTD PMID:17183730 and PMID:27188386 F12 Rat valproic acid increases expression ISO F12 (Homo sapiens) 6480464 Valproic Acid results in increased expression of F12 mRNA CTD PMID:26272509 and PMID:28001369 F12 Rat valproic acid decreases expression ISO F12 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of F12 mRNA CTD PMID:29154799 F12 Rat valproic acid increases methylation ISO F12 (Homo sapiens) 6480464 Valproic Acid results in increased methylation of F12 gene CTD PMID:29154799 F12 Rat valproic acid affects expression ISO F12 (Homo sapiens) 6480464 Valproic Acid affects the expression of F12 mRNA CTD PMID:25979313 F12 Rat zinc atom affects binding ISO F12 (Homo sapiens) 6480464 F12 protein binds to Zinc CTD PMID:23896426 F12 Rat zinc(0) affects binding ISO F12 (Homo sapiens) 6480464 F12 protein binds to Zinc CTD PMID:23896426
Imported Annotations - SMPDB
Imported Annotations - KEGG (archival)
(1->4)-beta-D-glucan (ISO) 17beta-estradiol (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 2,4-dinitrotoluene (EXP) 2,6-dinitrotoluene (EXP) 4,4'-sulfonyldiphenol (ISO) 5-aza-2'-deoxycytidine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aflatoxin B1 (ISO) antirheumatic drug (ISO) arsenous acid (ISO) benzo[a]pyrene (ISO) bisphenol A (EXP,ISO) bromobenzene (EXP) buta-1,3-diene (ISO) butanal (ISO) C60 fullerene (EXP) cadmium atom (ISO) CGP 52608 (ISO) chondroitin sulfate (ISO) cisplatin (ISO) clofibrate (ISO) cobalt dichloride (EXP) copper atom (ISO) copper(0) (ISO) Cuprizon (EXP) cycloheximide (ISO) cyclosporin A (ISO) diarsenic trioxide (ISO) disulfiram (ISO) dorsomorphin (ISO) EC 3.4.15.1 (peptidyl-dipeptidase A) inhibitor (ISO) ellagic acid (ISO) entinostat (ISO) Ethyl icosapentate (EXP) flutamide (EXP) furan (EXP) hydralazine (ISO) isoflavones (ISO) kaolin (ISO) methotrexate (ISO) N-nitrosodiethylamine (EXP) N-Nitrosopyrrolidine (ISO) nickel atom (ISO) niclosamide (ISO) nitrofen (EXP) O-methyleugenol (ISO) paracetamol (ISO) parathion (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (ISO) pirinixic acid (ISO) polyphosphates (ISO) pregnenolone 16alpha-carbonitrile (ISO) raloxifene (ISO) sarin (ISO) SB 431542 (ISO) sodium arsenite (ISO) sulforaphane (ISO) testosterone (ISO) tetrachloromethane (EXP) thimerosal (ISO) thioacetamide (EXP) Tributyltin oxide (ISO) trichloroethene (EXP) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) zinc atom (ISO) zinc(0) (ISO)
Biological Process
blood coagulation (IBA,IEA,ISO) Factor XII activation (IEA,ISO) fibrinolysis (IEA) hemostasis (IEA) plasma kallikrein-kinin cascade (IEA,ISO) positive regulation of blood coagulation (IEA,ISO) positive regulation of fibrinolysis (IEA,ISO) positive regulation of plasminogen activation (IEA,ISO) protein autoprocessing (IEA,ISO) protein processing (IEA,ISO) proteolysis (IEA) response to misfolded protein (IEA,ISO) zymogen activation (IBA,IEA,ISO)
1.
Coagulation factor XII (FXII) activity, activated FXII, distribution of FXII C46T gene polymorphism and coronary risk.
Bach J, etal., J Thromb Haemost. 2008 Feb;6(2):291-6. Epub 2007 Nov 15.
2.
A novel mutation in the coagulation factor 12 gene in subjects with hereditary angioedema and normal C1-inhibitor.
Bork K, etal., Clin Immunol. 2011 Oct;141(1):31-5. doi: 10.1016/j.clim.2011.07.002. Epub 2011 Jul 30.
3.
Human plasma prekallikrein, a zymogen to a serine protease that contains four tandem repeats.
Chung DW, etal., Biochemistry 1986 May 6;25(9):2410-7.
4.
Activation of the coagulation cascade in C1-inhibitor deficiencies.
Cugno M, etal., Blood. 1997 May 1;89(9):3213-8.
5.
Role of coagulation factor XII in unexplained recurrent abortions in the Greek population.
Dendrinos S, etal., J Reprod Med. 2014 Jan-Feb;59(1-2):56-62.
6.
Missense mutations in the coagulation factor XII (Hageman factor) gene in hereditary angioedema with normal C1 inhibitor.
Dewald G and Bork K, Biochem Biophys Res Commun. 2006 May 19;343(4):1286-9.
7.
Folate deficiency-induced hyperhomocysteinemia attenuates, and folic acid supplementation restores, the functional activities of rat coagulation factors XII, X, and II.
Ebbesen LS and Ingerslev J, J Nutr. 2005 Aug;135(8):1836-40.
8.
Evidence of a U-shaped association between factor XII activity and overall survival.
Endler G, etal., J Thromb Haemost. 2007 Jun;5(6):1143-8.
9.
A common C-->T polymorphism at nt 46 in the promoter region of coagulation factor XII is associated with decreased factor XII activity.
Endler G, etal., Thromb Res. 2001 Feb 15;101(4):255-60.
10.
Paternal endothelial protein C receptor 219Gly variant as a mild and limited risk factor for deep vein thrombosis during pregnancy.
Galanaud JP, etal., J Thromb Haemost. 2010 Apr;8(4):707-13. doi: 10.1111/j.1538-7836.2010.03770.x. Epub 2010 Feb 6.
11.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
12.
Hepatocytes express blood coagulation factor XII (Hageman factor).
Gordon EM, etal., J Lab Clin Med. 1990 Apr;115(4):463-9.
13.
Targeting coagulation factor XII provides protection from pathological thrombosis in cerebral ischemia without interfering with hemostasis.
Kleinschnitz C, etal., J Exp Med. 2006 Mar 20;203(3):513-8. Epub 2006 Mar 13.
14.
Haemostatic abnormalities persist despite glycaemic improvement by insulin therapy in lean type 2 diabetic patients.
Knobl P, etal., Thromb Haemost. 1994 Jun;71(6):692-7.
15.
Molecular genetic analysis of Korean patients with coagulation factor XII deficiency.
Kwon MJ, etal., Blood Coagul Fibrinolysis. 2010 Jun;21(4):308-12. doi: 10.1097/MBC.0b013e32833449df.
16.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
17.
Coagulation factor XII (Hageman factor) Washington D.C.: inactive factor XIIa results from Cys-571----Ser substitution.
Miyata T, etal., Proc Natl Acad Sci U S A. 1989 Nov;86(21):8319-22.
18.
Molecular analysis of multiple genetic variants in Spanish FXII-deficient families.
Mordillo C, etal., Haematologica. 2007 Nov;92(11):1569-72.
19.
The kallikrein-kinin system: current and future pharmacological targets.
Moreau ME, etal., J Pharmacol Sci. 2005 Sep;99(1):6-38.
20.
Effect of dienogest on bleeding time, coagulation, fibrinolysis, and platelet aggregation in female rats.
Nobukata H, etal., Toxicol Lett. 1999 Jan 11;104(1-2):93-101.
21.
Blood coagulation.
Norris LA, Best Pract Res Clin Obstet Gynaecol. 2003 Jun;17(3):369-83.
22.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
23.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
24.
SMPDB Annotation Import Pipeline
Pipeline to import SMPDB annotations from SMPDB into RGD
25.
Defective thrombus formation in mice lacking coagulation factor XII.
Renne T, etal., J Exp Med. 2005 Jul 18;202(2):271-81. Epub 2005 Jul 11.
26.
GOA pipeline
RGD automated data pipeline
27.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
28.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
29.
Synergistic association between hypercholesterolemia and the C46T factor XII polymorphism for developing premature myocardial infarction.
Roldan V, etal., Thromb Haemost. 2005 Dec;94(6):1294-9.
30.
Homozygosity of the T allele of the 46 C->T polymorphism in the F12 gene is a risk factor for ischemic stroke in the Spanish population.
Santamaria A, etal., Stroke. 2004 Aug;35(8):1795-9. Epub 2004 Jul 1.
31.
How it all starts: Initiation of the clotting cascade.
Smith SA, etal., Crit Rev Biochem Mol Biol. 2015;50(4):326-36. doi: 10.3109/10409238.2015.1050550. Epub 2015 May 28.
32.
Association after linkage analysis indicates that homozygosity for the 46C-->T polymorphism in the F12 gene is a genetic risk factor for venous thrombosis.
Tirado I, etal., Thromb Haemost. 2004 May;91(5):899-904.
33.
Preferential consumption of coagulation factors I, V, and VIII in rat endotoxemia.
Yamaguchi K, etal., Shock. 2000 Nov;14(5):535-43.
F12 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 17 9,212,819 - 9,220,664 (+) NCBI GRCr8 mRatBN7.2 17 9,207,683 - 9,215,530 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 17 9,207,683 - 9,215,530 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 17 9,223,730 - 9,231,646 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 17 10,753,767 - 10,761,675 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 17 9,220,120 - 9,228,036 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 17 9,736,577 - 9,744,420 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 17 9,736,577 - 9,744,420 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 17 11,845,561 - 11,853,600 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 17 15,251,611 - 15,259,583 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 17 15,251,610 - 15,259,583 (+) NCBI Celera 17 9,286,222 - 9,294,037 (+) NCBI Celera Cytogenetic Map 17 p14 NCBI
F12 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 5 177,402,141 - 177,409,564 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 5 177,402,133 - 177,416,583 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 5 176,829,142 - 176,836,565 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 5 176,761,745 - 176,769,183 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 5 176,761,746 - 176,769,183 NCBI Celera 5 171,664,877 - 171,672,315 (+) NCBI Celera Cytogenetic Map 5 q35.3 NCBI HuRef 5 171,749,566 - 171,757,004 (-) NCBI HuRef CHM1_1 5 176,262,187 - 176,269,625 (-) NCBI CHM1_1 T2T-CHM13v2.0 5 177,945,359 - 177,952,782 (-) NCBI T2T-CHM13v2.0
F12 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 13 55,565,771 - 55,574,617 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 13 55,565,771 - 55,574,606 (-) Ensembl GRCm39 Ensembl GRCm38 13 55,417,958 - 55,426,804 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 13 55,417,958 - 55,426,793 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 13 55,519,327 - 55,528,163 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 13 55,427,610 - 55,436,409 (-) NCBI MGSCv36 mm8 Celera 13 56,472,191 - 56,480,813 (-) NCBI Celera Cytogenetic Map 13 B1 NCBI cM Map 13 30.06 NCBI
F12 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955408 29,642,096 - 29,650,950 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955408 29,644,279 - 29,665,161 (-) NCBI ChiLan1.0 ChiLan1.0
F12 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 4 172,486,323 - 172,511,069 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 5 170,625,862 - 170,650,653 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 5 172,703,724 - 172,711,618 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 5 179,766,089 - 179,773,854 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 5 179,766,243 - 179,773,485 (-) Ensembl panpan1.1 panPan2
F12 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 4 35,950,642 - 35,968,137 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 4 35,950,695 - 35,998,025 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 4 35,918,068 - 35,935,563 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 4 36,316,872 - 36,334,363 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 4 36,316,904 - 36,324,807 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 4 36,142,096 - 36,159,589 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 4 36,328,310 - 36,345,800 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 4 36,837,547 - 36,855,039 (+) NCBI UU_Cfam_GSD_1.0
F12
F12
F12 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 23 79,414,074 - 79,438,896 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 23 79,414,225 - 79,432,298 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666075 10,603,660 - 10,619,663 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
F12
.
Predicted Target Of
Count of predictions: 59 Count of miRNA genes: 53 Interacting mature miRNAs: 58 Transcripts: ENSRNOT00000066586 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1354581 Bp247 Blood pressure QTL 247 4.5 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 17 1 69599340 Rat 631499 Stl1 Serum triglyceride level QTL 1 3.6 blood triglyceride amount (VT:0002644) blood triglyceride level (CMO:0000118) 17 3271398 27389946 Rat 2293664 Bmd28 Bone mineral density QTL 28 5.1 0.0001 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 17 4354487 27028127 Rat 1300123 Bp194 Blood pressure QTL 194 2.82 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 17 2115149 34551001 Rat 1582224 Epfw4 Epididymal fat weight QTL 4 3.5 0.0058 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 17 9201365 23653323 Rat 1582225 Bw67 Body weight QTL 67 6.2 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1582226 Bw64 Body weight QTL 64 4.2 0.0017 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1354651 Lmblg2 Limb length QTL 2 6 tibia length (VT:0004357) tibia length (CMO:0000450) 17 4299130 69599340 Rat 10401807 Kidm52 Kidney mass QTL 52 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 1 31701463 Rat 10054088 Scort28 Serum corticosterone level QTL 28 2.04 0.0102 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 4528038 49528038 Rat 1354630 Cm34 Cardiac mass QTL 34 8.7 heart left ventricle mass (VT:0007031) heart left ventricle wet weight (CMO:0000071) 17 4299130 69599340 Rat 1582208 Kidm32 Kidney mass QTL 32 3.9 0.0018 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 17 9201365 23653323 Rat 1354638 Insul1 Insulin level QTL 1 4.8 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 17 4299130 69599340 Rat 1354613 Kidm14 Kidney mass QTL 14 6.2 kidney mass (VT:0002707) left kidney wet weight (CMO:0000083) 17 4299130 35837242 Rat 2324619 Coatc4 Coat color QTL 4 0.001 coat/hair pigmentation trait (VT:0010463) pigmented dorsal coat/hair area to total dorsal coat/hair area ratio (CMO:0001811) 17 4299130 21293263 Rat 2303627 Vencon8 Ventilatory control QTL 8 0.001 respiration trait (VT:0001943) tidal volume (CMO:0000222) 17 4528038 49528038 Rat 70184 BpQTLcluster14 Blood pressure QTL cluster 14 3.38 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 17 1 31990913 Rat 1581553 Pur14 Proteinuria QTL 14 5.3 0.0001 urine total protein amount (VT:0000032) urine protein excretion rate (CMO:0000759) 17 7979968 16317111 Rat 2303561 Bw91 Body weight QTL 91 2 body mass (VT:0001259) body weight (CMO:0000012) 17 8868462 53868462 Rat 1582258 Bw76 Body weight QTL 76 4.6 0.0005 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 631207 Niddm41 Non-insulin dependent diabetes mellitus QTL 41 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 17 1 37830672 Rat 1582199 Insul5 Insulin level QTL 5 3.4 0.0119 blood insulin amount (VT:0001560) calculated serum insulin level (CMO:0000359) 17 9201365 23653323 Rat 1354596 Bw32 Body weight QTL 32 4.5 body mass (VT:0001259) body weight (CMO:0000012) 17 4299130 60781592 Rat 1354662 Rf49 Renal function QTL 49 2.9 blood creatinine amount (VT:0005328) plasma creatinine level (CMO:0000537) 17 1 69599340 Rat 2293648 Bmd31 Bone mineral density QTL 31 4.5 0.0001 femur size trait (VT:1000369) femoral neck cortical cross-sectional area (CMO:0001702) 17 4354487 27028127 Rat 1354658 Spl8 Serum phospholipid level QTL 8 3.8 blood VLDL phospholipid amount (VT:0010507) blood very low density lipoprotein phospholipid level (CMO:0001571) 17 1 60781592 Rat 1641902 Colcr7 Colorectal carcinoma resistance QTL 7 3.35 0.0044 intestine integrity trait (VT:0010554) benign colorectal tumor surface area measurement (CMO:0001799) 17 2115149 21881669 Rat 1582241 Bw70 Body weight QTL 70 4.6 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 1582245 Bw73 Body weight QTL 73 4.6 0.0004 body mass (VT:0001259) body weight (CMO:0000012) 17 9201365 23653323 Rat 9590316 Scort21 Serum corticosterone level QTL 21 4.75 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 17 1 22871563 Rat
BE102123
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 17 9,215,294 - 9,215,468 (+) MAPPER mRatBN7.2 Rnor_6.0 17 9,744,185 - 9,744,358 NCBI Rnor6.0 Rnor_5.0 17 11,853,365 - 11,853,538 UniSTS Rnor5.0 RGSC_v3.4 17 15,259,348 - 15,259,521 UniSTS RGSC3.4 Celera 17 9,293,802 - 9,293,975 UniSTS RH 3.4 Map 17 79.5 UniSTS Cytogenetic Map 17 p14 UniSTS
F12
Rat Assembly Chr Position (strand) Source JBrowse GRCr8 17 9,220,182 - 9,220,500 (+) Marker Load Pipeline mRatBN7.2 17 9,215,048 - 9,215,366 (+) MAPPER mRatBN7.2 Rnor_6.0 17 9,743,939 - 9,744,256 NCBI Rnor6.0 Rnor_5.0 17 11,853,119 - 11,853,436 UniSTS Rnor5.0 RGSC_v3.4 17 15,259,102 - 15,259,419 UniSTS RGSC3.4 Celera 17 9,293,556 - 9,293,873 UniSTS Cytogenetic Map 17 p14 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
8
25
107
91
88
59
25
59
6
183
70
87
37
50
29
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000066586 ⟹ ENSRNOP00000061983
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 9,207,683 - 9,215,530 (+) Ensembl Rnor_6.0 Ensembl 17 9,736,577 - 9,744,420 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000081920 ⟹ ENSRNOP00000074115
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 17 9,207,683 - 9,215,530 (+) Ensembl Rnor_6.0 Ensembl 17 9,736,786 - 9,744,341 (+) Ensembl
RefSeq Acc Id:
NM_001014006 ⟹ NP_001014028
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 17 9,212,819 - 9,220,664 (+) NCBI mRatBN7.2 17 9,207,683 - 9,215,530 (+) NCBI Rnor_6.0 17 9,736,577 - 9,744,420 (+) NCBI Rnor_5.0 17 11,845,561 - 11,853,600 (+) NCBI RGSC_v3.4 17 15,251,611 - 15,259,583 (+) RGD Celera 17 9,286,222 - 9,294,037 (+) RGD
Sequence:
CAGGAACCCATCTCGGTACTCTGCTTCCACCAGCCTTGCCCTGCTCACGAGGGTTCGACGGCGCTGTTCTTCTGGGCTTTCTGTGAAGTCTGTGCTCCTCAGGCCCAGGAGGGAGCTTAACCAATCTC
hide sequence
RefSeq Acc Id:
NP_001014028 ⟸ NM_001014006
- Peptide Label:
precursor
- UniProtKB:
A0A0H2UI19 (UniProtKB/TrEMBL)
- Sequence:
MTALLFLGSLLMSLDLTLSAPPWKSKEFKDGAGDPSVVLTVDGKLCHFPFQYHRRLYHKCIHKGQPGSRPWCATTPNFDEDQQWGYCLEPKKVKDHCSKHSPCHKGGTCVNTPNGPHCLCPEHLTGKH
hide sequence
Ensembl Acc Id:
ENSRNOP00000061983 ⟸ ENSRNOT00000066586
Ensembl Acc Id:
ENSRNOP00000074115 ⟸ ENSRNOT00000081920
RGD ID: 13700316 Promoter ID: EPDNEW_R10829 Type: multiple initiation site Name: F12_1 Description: coagulation factor XII SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 17 9,736,750 - 9,736,810 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-01-20
F12
coagulation factor XII
F12
coagulation factor XII
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-01-20
F12
coagulation factor XII
F12
coagulation factor XII
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2016-01-20
F12
coagulation factor XII
F12
coagulation factor XII (Hageman factor)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
F12
coagulation factor XII (Hageman factor)
LOC306761
similar to coagulation factor XII (Hageman factor); factor XII
Symbol and Name updated
1299863 APPROVED
2005-07-29
LOC306761
similar to coagulation factor XII (Hageman factor); factor XII
Symbol and Name status set to provisional
70820 PROVISIONAL
