Advanced Search (OLGA)

Gene: Or4d5 (olfactory receptor family 4 subfamily D member 5) Rattus norvegicus

Analyze

Symbol:

Or4d5

Name:

olfactory receptor family 4 subfamily D member 5

RGD ID:

1332863

Description:

Predicted to enable olfactory receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and detection of chemical stimulus involved in sensory perception of smell. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human OR4D5 (olfactory receptor family 4 subfamily D member 5); INTERACTS WITH bisphenol A; 3-methylcholanthrene (ortholog); cadmium atom (ortholog).

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

olfactory receptor 1339; olfactory receptor gene Olr1339; olfactory receptor Olr1339; Olr1339; ratchr8-43030000-43029056_ORF

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	49,321,020 - 49,321,964 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	49,321,020 - 49,321,964 (-)	Ensembl				GRCr8
mRatBN7.2	8	40,423,865 - 40,424,809 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	40,423,865 - 40,424,809 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	45,930,739 - 45,931,683 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	44,209,329 - 44,210,273 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	42,076,931 - 42,077,875 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	8	50,142,997 - 50,143,941 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	8	52,344,258 - 52,345,202 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	8	50,770,334 - 50,771,278 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	8	42,181,948 - 42,182,892 (-)	NCBI		F344_StmMcwi
Rnor_6.0	8	43,919,476 - 43,920,420 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	43,919,476 - 43,920,420 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	61,606,829 - 61,607,773 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	43,020,290 - 43,021,234 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	40,044,709 - 40,045,653 (-)	NCBI		Celera
RGSC_v3.1	8	43,029,055 - 43,030,000 (-)	NCBI
Cytogenetic Map	8	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

3-methylcholanthrene (ISO)

bisphenol A (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

detection of chemical stimulus involved in sensory perception of smell (IEA)

G protein-coupled receptor signaling pathway (IEA)

sensory perception of smell (IEA)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IBA,IEA)

Molecular Function

G protein-coupled receptor activity (IEA)

olfactory receptor activity (IBA,IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

taste/olfaction phenotype (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Genome sequence of the Brown Norway rat yields insights into mammalian evolution.	Gibbs RA, etal., Nature 2004 Apr 1;428(6982):493-521.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Comparative Map Data

Or4d5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	49,321,020 - 49,321,964 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	8	49,321,020 - 49,321,964 (-)	Ensembl				GRCr8
mRatBN7.2	8	40,423,865 - 40,424,809 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	40,423,865 - 40,424,809 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	8	45,930,739 - 45,931,683 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	44,209,329 - 44,210,273 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	42,076,931 - 42,077,875 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	8	50,142,997 - 50,143,941 (-)	NCBI		Dahl_SR_JrHsd
Lyon_Normotensive	8	52,344,258 - 52,345,202 (-)	NCBI		Lyon_Normotensive
Lyon_Hypertensive	8	50,770,334 - 50,771,278 (-)	NCBI		Lyon_Hypertensive
F344_StmMcwi	8	42,181,948 - 42,182,892 (-)	NCBI		F344_StmMcwi
Rnor_6.0	8	43,919,476 - 43,920,420 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	43,919,476 - 43,920,420 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	8	61,606,829 - 61,607,773 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	8	43,020,290 - 43,021,234 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	8	40,044,709 - 40,045,653 (-)	NCBI		Celera
RGSC_v3.1	8	43,029,055 - 43,030,000 (-)	NCBI
Cytogenetic Map	8	q22	NCBI

OR4D5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	123,939,617 - 123,940,573 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	123,939,617 - 123,940,573 (+)	Ensembl			hg38	GRCh38
GRCh37	11	123,810,324 - 123,811,280 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	123,315,534 - 123,316,490 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	123,315,533 - 123,316,490	NCBI
Celera	11	120,969,505 - 120,970,461 (+)	NCBI		Celera
Cytogenetic Map	11	q24.1	NCBI
HuRef	11	119,751,087 - 119,752,043 (+)	NCBI		HuRef
CHM1_1	11	123,696,495 - 123,697,451 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	123,968,219 - 123,969,175 (+)	NCBI		T2T-CHM13v2.0

Or4d5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	40,011,840 - 40,012,784 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	40,007,811 - 40,025,502 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	9	40,100,544 - 40,101,488 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	40,096,515 - 40,114,206 (-)	Ensembl			mm10	GRCm38
MGSCv37	9	39,908,129 - 39,909,073 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	9	39,851,115 - 39,852,059 (-)	NCBI		MGSCv36	mm8
Celera	9	37,339,422 - 37,340,366 (-)	NCBI		Celera
Cytogenetic Map	9	A5.1	NCBI
cM Map	9	21.39	NCBI

LOC102029164
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	24,581,506 - 24,582,450 (+)	Ensembl
ChiLan1.0	NW_004955412	24,570,586 - 24,582,450 (+)	NCBI	ChiLan1.0	ChiLan1.0

LOC100971133
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	124,636,417 - 124,637,373 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	125,740,890 - 125,741,846 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	118,767,919 - 118,769,000 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	122,684,720 - 122,685,801 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	122,684,788 - 122,685,744 (+)	Ensembl			panPan2	panpan1.1

OR4D5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	10,546,265 - 10,547,209 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	10,546,265 - 10,547,209 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	10,602,441 - 10,603,385 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	10,495,796 - 10,496,740 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	10,495,796 - 10,496,740 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	10,562,502 - 10,563,444 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	10,531,442 - 10,532,386 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	10,576,763 - 10,577,708 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Or4d5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	105,410,324 - 105,411,268 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936542	8,331,733 - 8,332,677 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936542	8,331,733 - 8,332,677 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100525119
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	50,758,169 - 50,759,113 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	9	50,758,169 - 50,759,113 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	56,047,748 - 56,048,692 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LOC103248709
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	115,059,694 - 115,243,313 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	115,241,918 - 115,242,874 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666043	10,973,249 - 11,037,350 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

LOC101700923
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624880	1,241,384 - 1,242,328 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624880	1,241,384 - 1,242,328 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

LOC116907689
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	8	82,878,375 - 82,879,319 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Or4d5
15 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	85
Count of miRNA genes:	67
Interacting mature miRNAs:	67
Transcripts:	ENSRNOT00000008246
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1357398	Slep3	Serum leptin concentration QTL 3	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	17994105	50763951	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	16994642	61994642	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
2317032	Ginf2	Gastrointestinal inflammation QTL 2	3.21	0.005	liver integrity trait (VT:0010547)	liver granuloma severity score (CMO:0002157)	8	12964165	57964165	Rat
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	15952279	60952279	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
2317036	Livw3	Liver weight QTL 3	2.43	0.01	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	8	12964165	57964165	Rat
12880023	Bw184	Body weight QTL 184		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	10382540	55382540	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
12880028	Cm103	Cardiac mass QTL 103		0.02	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	10382540	55382540	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	16994642	61994642	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
61337	Bp22	Blood pressure QTL 22	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	51589833	Rat
2317048	Ginf1	Gastrointestinal inflammation QTL 1	3.52	0.005	cecum mucosa thickness (VT:0010234)	enterocolitis severity score (CMO:0002138)	8	12964165	57964165	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
12880025	Cm102	Cardiac mass QTL 102		0.044	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	8	10382540	55382540	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
2302278	Gluco36	Glucose level QTL 36	4.2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	37760859	58991895	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	47541419	92541419	Rat
12880044	Am9	Aortic mass QTL 9		0.007	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	10382540	55382540	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	35464071	71842899	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	37760859	61459705	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	17993862	62252873	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	67378345	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
1359021	Bp271	Blood pressure QTL 271	1.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	34125902	55607752	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
2302367	Slep5	Serum leptin concentration QTL 5	3.43		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	8	17994105	50763951	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat
70206	Alc20	Alcohol consumption QTL 20	2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	8	39106258	49610361	Rat

Markers in Region

UniSTS:489391

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	8	49,321,020 - 49,321,964 (+)	Marker Load Pipeline
mRatBN7.2	8	40,423,864 - 40,424,809 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	43,919,476 - 43,920,420	NCBI	Rnor6.0
Rnor_5.0	8	61,606,829 - 61,607,773	UniSTS	Rnor5.0
RGSC_v3.4	8	43,020,290 - 43,021,234	UniSTS	RGSC3.4
Celera	8	40,044,709 - 40,045,653	UniSTS
Cytogenetic Map	8	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

endoderm	mesenchyme	renal system	reproductive system	respiratory system
1	2	2	1	1

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001000481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC111421	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000081179 ⟹ ENSRNOP00000073756

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	49,321,020 - 49,321,964 (-)	Ensembl
mRatBN7.2 Ensembl	8	40,423,865 - 40,424,809 (-)	Ensembl
Rnor_6.0 Ensembl	8	43,919,476 - 43,920,420 (-)	Ensembl

RefSeq Acc Id:

NM_001000481 ⟹ NP_001000481

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	49,321,020 - 49,321,964 (-)	NCBI
mRatBN7.2	8	40,423,865 - 40,424,809 (-)	NCBI
Dahl_SR_JrHsd	8	50,142,997 - 50,143,941 (-)	NCBI
Lyon_Normotensive	8	52,344,258 - 52,345,202 (-)	NCBI
Lyon_Hypertensive	8	50,770,334 - 50,771,278 (-)	NCBI
F344_StmMcwi	8	42,181,948 - 42,182,892 (-)	NCBI
Rnor_6.0	8	43,919,476 - 43,920,420 (-)	NCBI
Rnor_5.0	8	61,606,829 - 61,607,773 (+)	NCBI
RGSC_v3.4	8	43,020,290 - 43,021,234 (-)	RGD
Celera	8	40,044,709 - 40,045,653 (-)	RGD

Sequence:

show sequence

ATGAACCCAGCAAACCATTCCCAGGTGGCAACGTTCGTCCTCCTGGGGCTCTCTCAGGTATGGG
AGCTTCGGCTCCTGTTCTTCACTGTTTTCTCAGCCGTGTATCTTTTGACTGTCGCTGGCAATCT
TCTCATTGTGGCCATAGTGACCTCCGACCCGCGCTTGCACACAACTATGTATTTTCTCTTAGGC
AACCTTTCATTCTTGGACTTCTGCTACTCTTCTATCACTGCCCCCAGGATGCTGGTTGACTTGC
TCTCACACAACCCCACCATTTCCTTTGGTGCCTGCCTGACTCAGCTGTTCTTTTTCCACTTCAT
TGGAGGCATCAAGATATTCCTGCTGACTGTCATGGCATATGACCGTTACATTGCCATTTGCCAG
CCCCTCCGCTACACGGTAATTATGAATCAGACGGTCTGTGGGCTCTTCATGGGAGCCTCATGGG
TGGGTGGTTTTATCCATTCCATTGTACAAATTGGACTGACTATCCACCTGCCATTTTGTGGTCC
TGACAAGCTGGACAACTTCTATTGTGATGTGCCACAGCTGATCAAATTGGCCTGCACCGATACC
TTTGTCTTAGAGCTTCTGATGGTGTCTAACAATGGCTTGGTCACTCTCATGTGCTTTCTGGTGC
TGCTGGGCCCCTACACAGCCCTGCTTGTGATGCTCCGAAGTCACTCTAAGGAGGGTCGTAGCAA
GGCCCTGTCTACCTGTGCCTCTCACATTGCTGTGGTGACAATAATTTTTGTGCCTTGCATCTAC
ATCTATGCAAGACCTTTTAGGACATTCCCCATGGATAAGGCAGTTTCTGTGCTATATACAATGG
TCACTCCCATGCTGAATCCTGCCATTTATACCCTGAGAAATAAAGAAGTGATTGCAGCCATGAA
GAAGCTGTGGAGGAGGCAGAAGGATTTTCTTGGTCCCTCAGATCATTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001000481	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL95218	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073756
	ENSRNOP00000073756.1

RefSeq Acc Id:

NP_001000481 ⟸ NM_001000481

- UniProtKB:

D3ZLT4 (UniProtKB/TrEMBL), A6J3P5 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNPANHSQVATFVLLGLSQVWELRLLFFTVFSAVYLLTVAGNLLIVAIVTSDPRLHTTMYFLLG
NLSFLDFCYSSITAPRMLVDLLSHNPTISFGACLTQLFFFHFIGGIKIFLLTVMAYDRYIAICQ
PLRYTVIMNQTVCGLFMGASWVGGFIHSIVQIGLTIHLPFCGPDKLDNFYCDVPQLIKLACTDT
FVLELLMVSNNGLVTLMCFLVLLGPYTALLVMLRSHSKEGRSKALSTCASHIAVVTIIFVPCIY
IYARPFRTFPMDKAVSVLYTMVTPMLNPAIYTLRNKEVIAAMKKLWRRQKDFLGPSDH

hide sequence

Ensembl Acc Id:

ENSRNOP00000073756 ⟸ ENSRNOT00000081179

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZLT4-F1-model_v2	AlphaFold	D3ZLT4	1-314	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1332863	AgrOrtholog
BioCyc Gene	G2FUF-30851	BioCyc
Ensembl Genes	ENSRNOG00000059611	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000081179	ENTREZGENE
	ENSRNOT00000081179.3	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/TrEMBL
InterPro	7TM_GPCR_Rhodpsn	UniProtKB/TrEMBL
	GPCR_Rhodpsn_supfam	UniProtKB/TrEMBL
	Olfact_rcpt	UniProtKB/TrEMBL
	Olfactory_Receptors	UniProtKB/TrEMBL
KEGG Report	rno:300639	UniProtKB/TrEMBL
NCBI Gene	300639	ENTREZGENE
PANTHER	OLFACTORY RECEPTOR	UniProtKB/TrEMBL
Pfam	7tm_4	UniProtKB/TrEMBL
PhenoGen	Or4d5	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/TrEMBL
	OLFACTORYR	UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000059611	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/TrEMBL
UniProt	A6J3P5	ENTREZGENE, UniProtKB/TrEMBL
	D3ZLT4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-08-16	Or4d5	olfactory receptor family 4 subfamily D member 5	Olr1339	olfactory receptor 1339	Symbol and Name Changed	1299863	APPROVED
2008-04-30	Olr1339	olfactory receptor 1339	Olr1339_predicted	olfactory receptor 1339 (predicted)	'predicted' is removed	2292626	APPROVED
2005-02-04	Olr1339_predicted	olfactory receptor 1339 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Mammalian Phenotype