Advanced Search (OLGA)

Gene: Nkapl (NFKB activating protein-like) Rattus norvegicus

Analyze

Symbol:

Nkapl

Name:

NFKB activating protein-like

RGD ID:

1311667

Description:

Predicted to enable chromatin binding activity. Predicted to be involved in regulation of gene expression. Predicted to be active in nucleus. Orthologous to human NKAPL (NFKB activating protein like); INTERACTS WITH bisphenol A; cadmium dichloride; dimethylarsinic acid.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC291165; MGC114538; NKAP-like protein; RGD1311667; similar to RIKEN cDNA 4921504I05

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NKAPL (NFKB activating protein like)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI
Mus musculus (house mouse):	Nkapl (NFKB activating protein-like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nkapl (NFKB activating protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NKAPL (NFKB activating protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NKAPL (NFKB activating protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nkapl (NFKB activating protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NKAPL (NFKB activating protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NKAPL (NFKB activating protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nkapl (NFKB activating protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Nkapl (NFKB activating protein like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NKAP (NFKB activating protein)	HGNC	OrthoDB
Homo sapiens (human):	ERLEC1 (endoplasmic reticulum lectin 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NKAPL (NFKB activating protein like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nkapl (NFKB activating protein-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nkap (NFKB activating protein)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	let-504	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	let-504	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6066	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG6066	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nkap	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	nkap	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	47,830,828 - 47,832,345 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	47,829,788 - 47,834,443 (+)	Ensembl				GRCr8
mRatBN7.2	17	43,135,096 - 43,136,613 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	43,135,096 - 43,136,613 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	45,192,555 - 45,194,072 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	49,951,667 - 49,953,184 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	44,442,002 - 44,443,519 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	45,175,254 - 45,176,771 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	45,175,121 - 45,176,678 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	58,291,326 - 58,292,843 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	50,777,832 - 50,779,349 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	53,331,504 - 53,333,021 (-)	NCBI		Celera
RGSC_v3.1	17	50,780,672 - 50,782,190 (+)	NCBI
Cytogenetic Map	17	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP)

dimethylarsinic acid (EXP)

fulvestrant (ISO)

glyphosate (EXP)

sodium arsenite (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

regulation of gene expression (IBA)

Cellular Component

nucleus (IBA)

Molecular Function

chromatin binding (IEA)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Nkapl
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	47,830,828 - 47,832,345 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	47,829,788 - 47,834,443 (+)	Ensembl				GRCr8
mRatBN7.2	17	43,135,096 - 43,136,613 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	43,135,096 - 43,136,613 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	45,192,555 - 45,194,072 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	49,951,667 - 49,953,184 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	44,442,002 - 44,443,519 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	45,175,254 - 45,176,771 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	45,175,121 - 45,176,678 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	58,291,326 - 58,292,843 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	50,777,832 - 50,779,349 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	53,331,504 - 53,333,021 (-)	NCBI		Celera
RGSC_v3.1	17	50,780,672 - 50,782,190 (+)	NCBI
Cytogenetic Map	17	p11	NCBI

NKAPL
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	28,259,297 - 28,260,958 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	28,259,297 - 28,260,958 (+)	Ensembl			hg38	GRCh38
GRCh37	6	28,227,075 - 28,228,736 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	28,335,077 - 28,336,715 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	6	29,833,544 - 29,835,182 (+)	NCBI		Celera
Cytogenetic Map	6	p22.1	NCBI
HuRef	6	28,034,730 - 28,036,391 (+)	NCBI		HuRef
CHM1_1	6	28,229,440 - 28,231,101 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	28,131,026 - 28,132,687 (+)	NCBI		T2T-CHM13v2.0

Nkapl
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	21,651,217 - 21,652,671 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	21,651,217 - 21,652,679 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	21,467,047 - 21,468,501 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	21,467,047 - 21,468,509 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	21,558,916 - 21,560,370 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	21,474,564 - 21,475,952 (-)	NCBI		MGSCv36	mm8
Celera	13	21,732,819 - 21,734,273 (-)	NCBI		Celera
Cytogenetic Map	13	A3.1	NCBI
cM Map	13	7.81	NCBI

Nkapl
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955465	13,621,867 - 13,623,189 (+)	NCBI	ChiLan1.0	ChiLan1.0

NKAPL
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	42,874,551 - 42,877,081 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	38,875,408 - 38,877,938 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	28,061,936 - 28,063,581 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	28,734,203 - 28,735,848 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	28,734,272 - 28,735,471 (+)	Ensembl			panPan2	panpan1.1

NKAPL
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	25,399,054 - 25,400,592 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	25,398,717 - 25,415,382 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	25,257,156 - 25,258,690 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	25,697,074 - 25,698,608 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	25,697,177 - 25,713,632 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	25,361,904 - 25,363,438 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	25,414,931 - 25,416,465 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	26,884,576 - 26,886,108 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Nkapl
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	28,680,660 - 28,683,596 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936772	103,304 - 104,524 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NKAPL
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	22,108,647 - 22,110,123 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	22,108,573 - 22,110,130 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	24,052,469 - 24,054,155 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NKAPL
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	44,305,446 - 44,323,491 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666044	27,949,005 - 27,950,931 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nkapl
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624756	24,637,721 - 24,639,251 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Nkapl
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	40,983,650 - 40,985,197 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Nkapl
5 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	23
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000049742
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
8552966	Pigfal18	Plasma insulin-like growth factor 1 level QTL 18	8.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	12860942	57860942	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
1354654	Spl7	Serum phospholipid level QTL 7	5.5		blood phospholipid amount (VT:0006084)	blood phospholipid level (CMO:0001169)	17	38031354	83031354	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22660799	55604694	Rat
9589151	Insul30	Insulin level QTL 30	8.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	12860942	57860942	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40968017	89341781	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21498994	50592236	Rat
1354629	Scl31	Serum cholesterol level QTL 31	4.1		blood cholesterol amount (VT:0000180)	blood total cholesterol level (CMO:0000051)	17	38031354	83031354	Rat
1600398	Edcs5	Endometrial carcinoma susceptibility QTL 5	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	17	35446949	75762341	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
9590154	Scort9	Serum corticosterone level QTL 9	23.57	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	12860942	57860942	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	38031354	83031354	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	38031354	83031354	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15537025	60531414	Rat
7411666	Foco31	Food consumption QTL 31	11.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	17	12860942	57860942	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	46050126	91050126	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4733534	49733534	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27233445	65155015	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	42654895	87654895	Rat
1300129	Rf25	Renal function QTL 25	3.03		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	17	41062352	86062352	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	32199534	86201342	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	36045537	81045537	Rat
70210	Cm15	Cardiac mass QTL 15	6.5		heart right ventricle mass (VT:0007033)	heart right ventricle wet weight (CMO:0000072)	17	30066472	75066472	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	42388164	87388164	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	33104645	78104645	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	32199534	49497050	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4733534	49733534	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23286322	64246472	Rat
9589057	Scfw6	Subcutaneous fat weight QTL 6	8.62	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	17	12860942	57860942	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	26522051	71522051	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	22019705	67019705	Rat
9590088	Insglur7	Insulin/glucose ratio QTL 7	20.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	17	12860942	57860942	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	32199534	55604694	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	10604694	55604694	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	33104645	78104645	Rat
12904736	Cm121	Cardiac mass QTL 121		0.043	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	42388164	87388164	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23858926	68858926	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27233445	72233445	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23858926	68858926	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23858926	68858926	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23858926	68858926	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	37687877	82687877	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23858926	68858926	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
8	10	54	128	54	53	22	30	22	3	210	112	11	108	60	84	31	8	8

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001029913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC097473	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000080417 ⟹ ENSRNOP00000074151

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	47,830,530 - 47,832,228 (+)	Ensembl
mRatBN7.2 Ensembl	17	43,135,096 - 43,136,613 (+)	Ensembl
Rnor_6.0 Ensembl	17	45,175,121 - 45,176,678 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000162608 ⟹ ENSRNOP00000108455

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	47,829,990 - 47,834,050 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000167278 ⟹ ENSRNOP00000110846

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	47,829,788 - 47,834,443 (+)	Ensembl

RefSeq Acc Id:

NM_001029913 ⟹ NP_001025084

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	47,830,828 - 47,832,345 (+)	NCBI
mRatBN7.2	17	43,135,096 - 43,136,613 (+)	NCBI
Rnor_6.0	17	45,175,254 - 45,176,771 (+)	NCBI
Rnor_5.0	17	58,291,326 - 58,292,843 (-)	NCBI
RGSC_v3.4	17	50,777,832 - 50,779,349 (+)	RGD
Celera	17	53,331,504 - 53,333,021 (-)	RGD

Sequence:

show sequence

GACTTCTGGAATAACCGCCGTGTTGGTTGATTGAAGGCAGTCCATGTCGCCTGTACCAGGATCC
CGCCCTAATGAGGACACTCTGGGCTCTCAGAAACGACGACGAGGCTCGGAGAGCCCACCGTCGG
TGTTGCAGACTAGTCGATTCTCTCGGGGTTTTTGCTCTCACCTCAGCGGGCCTGAGGGGCTCCA
GCCTCCGCGGGGTGCGGACGGCGTCCGGCCGCTGCATTCGGTCAGCCGCCCCAGATCTGGAGAA
CGACCGCTATCGCTGGGAATCCGTACTCTTGCCTCATCGTCCTCTCCCATCTGTGGTGGATACC
GTTACCACCATAACTATGCGGGAGACTGTTCGTGGTCTGAGGACCAGGAGAAGGAAAAGGAGGA
GAGCTATAGGCAAAGGAGGCTGAAGGAAAGGGAGAGGATTGGAGAACTGGGAGCGCCTGAAGTA
TGGGGACTGTCACCCAAGATTCCTGAGCCAGATTCTGATGAACATACACCAGCTGAAGATGAGG
TGAAGAATCAGAAGAGCAGCAGTTCAGATTTAACCAACGAAGAAAAAAGGACCAAGACCAGTCA
TTCAACAAAGAAAAAAAGAAAGAAAAAGCCTTCCAAAAAGAAGCATAAAAAATATGACAGCAAT
TCAGACTCAGACATTCATTCCAGCTCTGATAGTGATAAAAACAAAGTTAAAATCAAGAAGAAAG
AGAAGAAAAAGAAACATCGGGCGAAAGAACTCAAGAAGAAAAAGAGAACCAAAAAAGAATACAA
TGGCATAAGCTGCAAAGCTTCAGGAAGGGAATTGCCGGAAGATGTGTGGATGGAACAGTCGATG
AGTGCAGATAGCACAGATTTAATAGGTCCAGAAGCACCTGTTACACATACCTCACAAGATGAGA
AACCTTTGAATTATGGCCACGCTCTACTTCCAGGTGAAGGTGCAGCAATGGCTGAATATGTAAA
AGCTGGGAAGCGTATCCCACGAAGAGGTGAAATTGGGTTGACAAGTGAAGAGATTGCCTCATTT
GAATGTTCAGGTTATGTCATGAGTGGTAGCAGGCATCGCCGAATGGAGGCTGTAAGACTGCGAA
AAGAGAACCAGATTTACAGTGCGGATGAGAAACGAGCCCTGGCATCCTTTAACCAAGAAGAGAG
GCGGAAGAGAGAGAATAAGATCCTAGCCAGCTTTCGAGAAATGGTATACAGAAAGACAAAAGGG
AAAGATGACAAGTGACAACTTTTTTGTTTCACTGCGGGACATTTAACAACAAAGGCTTTGTATG
ACCAAAGTAATAGTAAATGGTAAAACCATTAGGTACTATCGTACCTACTGTTTTAGTAGAAAGC
ACATCTTAAGATGTCATTAGAAAGTTTTACAAACATTGCAGGAGAATGACTAAAAAGGTAAATG
TCACTTCAGTCCATGATTTACCTCCCTTTAAAAACAGTGTCTTCTGTATCCTGTGGTTTTTGTT
CATATACAAGTTTGTGTTTTGGAAAATAAAAGTTAGTGCTACTAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001025084	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH97473	(Get FASTA)	NCBI Sequence Viewer
	EDL84550	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074151
	ENSRNOP00000074151.1
	ENSRNOP00000108455.1
	ENSRNOP00000110846.1

RefSeq Acc Id:

NP_001025084 ⟸ NM_001029913

- UniProtKB:

Q4QR70 (UniProtKB/TrEMBL), A6KN82 (UniProtKB/TrEMBL), G3V9G8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSPVPGSRPNEDTLGSQKRRRGSESPPSVLQTSRFSRGFCSHLSGPEGLQPPRGADGVRPLHSV
SRPRSGERPLSLGIRTLASSSSPICGGYRYHHNYAGDCSWSEDQEKEKEESYRQRRLKERERIG
ELGAPEVWGLSPKIPEPDSDEHTPAEDEVKNQKSSSSDLTNEEKRTKTSHSTKKKRKKKPSKKK
HKKYDSNSDSDIHSSSDSDKNKVKIKKKEKKKKHRAKELKKKKRTKKEYNGISCKASGRELPED
VWMEQSMSADSTDLIGPEAPVTHTSQDEKPLNYGHALLPGEGAAMAEYVKAGKRIPRRGEIGLT
SEEIASFECSGYVMSGSRHRRMEAVRLRKENQIYSADEKRALASFNQEERRKRENKILASFREM
VYRKTKGKDDK

hide sequence

Ensembl Acc Id:

ENSRNOP00000074151 ⟸ ENSRNOT00000080417

Ensembl Acc Id:

ENSRNOP00000110846 ⟸ ENSRNOT00000167278

Ensembl Acc Id:

ENSRNOP00000108455 ⟸ ENSRNOT00000162608

Protein Domains

NF-kappa-B-activating protein C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V9G8-F1-model_v2	AlphaFold	G3V9G8	1-395	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311667	AgrOrtholog
BioCyc Gene	G2FUF-9218	BioCyc
Ensembl Genes	ENSRNOG00000056708	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000080417	ENTREZGENE
	ENSRNOT00000080417.3	UniProtKB/TrEMBL
	ENSRNOT00000162608.1	UniProtKB/TrEMBL
	ENSRNOT00000167278.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7457806	IMAGE-MGC_LOAD
InterPro	DUF926	UniProtKB/TrEMBL
	NKAP	UniProtKB/TrEMBL
KEGG Report	rno:291165	UniProtKB/TrEMBL
MGC_CLONE	MGC:114538	IMAGE-MGC_LOAD
NCBI Gene	291165	ENTREZGENE
PANTHER	NKAP-LIKE PROTEIN	UniProtKB/TrEMBL
	PTHR13087	UniProtKB/TrEMBL
Pfam	SynMuv_product	UniProtKB/TrEMBL
PhenoGen	Nkapl	PhenoGen
RatGTEx	ENSRNOG00000056708	RatGTEx
UniProt	A6KN82	ENTREZGENE, UniProtKB/TrEMBL
	G3V9G8	ENTREZGENE, UniProtKB/TrEMBL
	Q4QR70	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-02-27	Nkapl	NFKB activating protein-like	RGD1311667	similar to RIKEN cDNA 4921504I05	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	RGD1311667	similar to RIKEN cDNA 4921504I05	RGD1311667_predicted	similar to RIKEN cDNA 4921504I05 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1311667_predicted	similar to RIKEN cDNA 4921504I05 (predicted)	LOC291165_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC291165_predicted	similar to RIKEN cDNA 4921504I05 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD