Advanced Search (OLGA)

Gene: Pcgf3 (polycomb group ring finger 3) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Pcgf3

Name:

polycomb group ring finger 3

RGD ID:

1311479

Description:

Predicted to enable histone H2AK119 ubiquitin ligase activity. Predicted to be involved in random inactivation of X chromosome and regulation of transcription by RNA polymerase II. Predicted to be located in X chromosome and nucleoplasm. Predicted to be part of PRC1 complex. Orthologous to human PCGF3 (polycomb group ring finger 3); PARTICIPATES IN histone modification pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC305624; polycomb group RING finger protein 3; ring finger protein 3; Rnf3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PCGF3 (polycomb group ring finger 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Pcgf3 (polycomb group ring finger 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pcgf3 (polycomb group ring finger 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PCGF3 (polycomb group ring finger 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PCGF3 (polycomb group ring finger 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pcgf3 (polycomb group ring finger 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PCGF3 (polycomb group ring finger 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PCGF3 (polycomb group ring finger 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pcgf3 (polycomb group ring finger 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PCGF3 (polycomb group ring finger 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pcgf3 (polycomb group ring finger 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mig-32	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	l(3)73Ah	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pcgf3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

NCBI Annotation Information:

Annotation category: suggests misassembly; Annotation category: partial on reference assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	1,381,976 - 1,436,709 (-)	NCBI		GRCr8
mRatBN7.2	14	1,237,594 - 1,291,717 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	1,233,947 - 1,291,793 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	1,136,329 - 1,173,467 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	2,438,091 - 2,475,222 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	1,134,803 - 1,171,901 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	2,247,805 - 2,297,155 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	2,247,808 - 2,297,155 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	2,242,206 - 2,295,509 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	1,824,819 - 1,839,263 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	1,784,275 - 1,835,105 (-)	NCBI
Celera	14	1,276,942 - 1,313,583 (-)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcgf3	Rat	cherubism		ISO	PCGF3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: Fibrous dysplasia of jaw	ClinVar	PMID:28492532
Pcgf3	Rat	Mental Retardation, Autosomal Recessive 53		ISO	PCGF3 (Homo sapiens)	8554872	ClinVar Annotator: match by term: NEURODEVELOPMENTAL DISORDER WITH OR WITHOUT HYPOTONIA more ...	ClinVar	PMID:26996948 more ...

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcgf3	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	Pcgf3 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PCGF3 mRNA	CTD	PMID:36331819
Pcgf3	Rat	1,2-dimethylhydrazine	decreases expression	ISO	Pcgf3 (Mus musculus)	6480464	1 and 2-Dimethylhydrazine results in decreased expression of PCGF3 mRNA	CTD	PMID:22206623
Pcgf3	Rat	17alpha-ethynylestradiol	increases expression	EXP		6480464	Ethinyl Estradiol results in increased expression of PCGF3 mRNA	CTD	PMID:29097150
Pcgf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Pcgf3 (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of PCGF3 mRNA	CTD	PMID:21570461
Pcgf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PCGF3 mRNA	CTD	PMID:33387578
Pcgf3	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PCGF3 mRNA	CTD	PMID:32109520
Pcgf3	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of PCGF3 mRNA	CTD	PMID:25825206
Pcgf3	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of PCGF3 mRNA	CTD	PMID:30047161
Pcgf3	Rat	aflatoxin B1	decreases methylation	ISO	PCGF3 (Homo sapiens)	6480464	Aflatoxin B1 results in decreased methylation of PCGF3 gene	CTD	PMID:27153756
Pcgf3	Rat	aflatoxin B1	increases methylation	ISO	PCGF3 (Homo sapiens)	6480464	Aflatoxin B1 results in increased methylation of PCGF3 intron	CTD	PMID:30157460
Pcgf3	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of PCGF3 mRNA	CTD	PMID:30047161
Pcgf3	Rat	antirheumatic drug	decreases expression	ISO	PCGF3 (Homo sapiens)	6480464	Antirheumatic Agents results in decreased expression of PCGF3 mRNA	CTD	PMID:24449571
Pcgf3	Rat	arsane	affects methylation	ISO	PCGF3 (Homo sapiens)	6480464	Arsenic affects the methylation of PCGF3 gene	CTD	PMID:25304211
Pcgf3	Rat	arsenic atom	affects methylation	ISO	PCGF3 (Homo sapiens)	6480464	Arsenic affects the methylation of PCGF3 gene	CTD	PMID:25304211
Pcgf3	Rat	arsenite(3-)	multiple interactions	ISO	PCGF3 (Homo sapiens)	6480464	arsenite inhibits the reaction [G3BP1 protein binds to PCGF3 mRNA]	CTD	PMID:32406909
Pcgf3	Rat	atrazine	increases expression	ISO	PCGF3 (Homo sapiens)	6480464	Atrazine results in increased expression of PCGF3 mRNA	CTD	PMID:22378314
Pcgf3	Rat	benzo[a]pyrene	affects methylation	ISO	PCGF3 (Homo sapiens)	6480464	Benzo(a)pyrene affects the methylation of PCGF3 5' UTR and Benzo(a)pyrene affects the methylation of PCGF3 intron	CTD	PMID:27901495 and PMID:30157460
Pcgf3	Rat	benzo[e]pyrene	increases methylation	ISO	PCGF3 (Homo sapiens)	6480464	benzo(e)pyrene results in increased methylation of PCGF3 intron	CTD	PMID:30157460
Pcgf3	Rat	bisphenol A	increases expression	ISO	Pcgf3 (Mus musculus)	6480464	bisphenol A results in increased expression of PCGF3 mRNA	CTD	PMID:26063408
Pcgf3	Rat	bisphenol A	decreases methylation	ISO	PCGF3 (Homo sapiens)	6480464	bisphenol A results in decreased methylation of PCGF3 gene	CTD	PMID:31601247
Pcgf3	Rat	bisphenol A	decreases expression	ISO	Pcgf3 (Mus musculus)	6480464	bisphenol A results in decreased expression of PCGF3 mRNA	CTD	PMID:33221593
Pcgf3	Rat	bisphenol A	increases methylation	EXP		6480464	bisphenol A results in increased methylation of PCGF3 gene	CTD	PMID:28505145
Pcgf3	Rat	bisphenol A	increases methylation	ISO	Pcgf3 (Mus musculus)	6480464	bisphenol A results in increased methylation of PCGF3 promoter	CTD	PMID:27312807
Pcgf3	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PCGF3 mRNA	CTD	PMID:25181051 and PMID:29097150
Pcgf3	Rat	bisphenol F	increases expression	ISO	Pcgf3 (Mus musculus)	6480464	bisphenol F results in increased expression of PCGF3 mRNA	CTD	PMID:38685157
Pcgf3	Rat	bortezomib	increases expression	ISO	PCGF3 (Homo sapiens)	6480464	Bortezomib results in increased expression of PCGF3 mRNA	CTD	PMID:20977926
Pcgf3	Rat	butanal	decreases expression	ISO	PCGF3 (Homo sapiens)	6480464	butyraldehyde results in decreased expression of PCGF3 mRNA	CTD	PMID:26079696
Pcgf3	Rat	cadmium dichloride	decreases expression	ISO	PCGF3 (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of PCGF3 mRNA	CTD	PMID:38382870
Pcgf3	Rat	Dibutyl phosphate	affects expression	ISO	PCGF3 (Homo sapiens)	6480464	di-n-butylphosphoric acid affects the expression of PCGF3 mRNA	CTD	PMID:37042841
Pcgf3	Rat	dibutyl phthalate	increases expression	EXP		6480464	Dibutyl Phthalate results in increased expression of PCGF3 mRNA	CTD	PMID:21266533
Pcgf3	Rat	ethanol	affects splicing	ISO	Pcgf3 (Mus musculus)	6480464	Ethanol affects the splicing of PCGF3 mRNA	CTD	PMID:30319688
Pcgf3	Rat	folic acid	increases expression	ISO	PCGF3 (Homo sapiens)	6480464	Folic Acid results in increased expression of PCGF3 mRNA	CTD	PMID:21867686
Pcgf3	Rat	fulvestrant	increases methylation	ISO	PCGF3 (Homo sapiens)	6480464	Fulvestrant results in increased methylation of PCGF3 gene	CTD	PMID:31601247
Pcgf3	Rat	inulin	multiple interactions	ISO	Pcgf3 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PCGF3 mRNA	CTD	PMID:36331819
Pcgf3	Rat	methapyrilene	decreases expression	EXP		6480464	Methapyrilene results in decreased expression of PCGF3 mRNA	CTD	PMID:30467583
Pcgf3	Rat	methapyrilene	increases methylation	ISO	PCGF3 (Homo sapiens)	6480464	Methapyrilene results in increased methylation of PCGF3 intron	CTD	PMID:30157460
Pcgf3	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of PCGF3 mRNA	CTD	PMID:30047161
Pcgf3	Rat	mitomycin C	increases expression	ISO	Pcgf3 (Mus musculus)	6480464	Mitomycin results in increased expression of PCGF3 mRNA	CTD	PMID:25270620
Pcgf3	Rat	N,N-diethyl-m-toluamide	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of PCGF3 gene	CTD	PMID:33148267
Pcgf3	Rat	paracetamol	affects expression	ISO	Pcgf3 (Mus musculus)	6480464	Acetaminophen affects the expression of PCGF3 mRNA	CTD	PMID:17562736
Pcgf3	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	Pcgf3 (Mus musculus)	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PCGF3 mRNA more ...	CTD	PMID:36331819
Pcgf3	Rat	permethrin	multiple interactions	EXP		6480464	[Permethrin co-treated with DEET] results in decreased methylation of PCGF3 gene	CTD	PMID:33148267
Pcgf3	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of PCGF3 mRNA	CTD	PMID:30047161
Pcgf3	Rat	sunitinib	decreases expression	ISO	PCGF3 (Homo sapiens)	6480464	Sunitinib results in decreased expression of PCGF3 mRNA	CTD	PMID:31533062
Pcgf3	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of PCGF3 mRNA	CTD	PMID:23411599 and PMID:34492290
Pcgf3	Rat	titanium dioxide	increases methylation	ISO	Pcgf3 (Mus musculus)	6480464	titanium dioxide results in increased methylation of PCGF3 promoter	CTD	PMID:35295148
Pcgf3	Rat	trichostatin A	decreases expression	ISO	PCGF3 (Homo sapiens)	6480464	trichostatin A results in decreased expression of PCGF3 mRNA	CTD	PMID:26272509
Pcgf3	Rat	valproic acid	increases methylation	ISO	PCGF3 (Homo sapiens)	6480464	Valproic Acid results in increased methylation of PCGF3 gene	CTD	PMID:29154799
Pcgf3	Rat	valproic acid	decreases expression	ISO	PCGF3 (Homo sapiens)	6480464	Valproic Acid results in decreased expression of PCGF3 mRNA	CTD	PMID:26272509

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcgf3	Rat	biological_process		ND		1598407	10/2014: no relevant rat data	RGD
Pcgf3	Rat	random inactivation of X chromosome	involved_in	ISO	Pcgf3 (Mus musculus)	1624291	PMID:28596365	RGD	PMID:28596365
Pcgf3	Rat	regulation of transcription by RNA polymerase II	involved_in	IBA	MGI:1918291 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcgf3	Rat	nucleoplasm	located_in	IEA	UniProtKB:Q3KNV8 and ensembl:ENSP00000354724	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pcgf3	Rat	nucleoplasm	located_in	ISO	PCGF3 (Homo sapiens) and UniProtKB:Q3KNV8-1	1624291		RGD	GO_REF:0000052
Pcgf3	Rat	nucleus	located_in	ISO	PCGF3 (Homo sapiens)	1624291	PMID:21282530	RGD	PMID:21282530
Pcgf3	Rat	nucleus	located_in	IEA	UniProtKB-SubCell:SL-0191	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pcgf3	Rat	nucleus	located_in	IEA	UniProtKB:Q3KNV8 and ensembl:ENSP00000354724	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pcgf3	Rat	PcG protein complex	part_of	ISO	PCGF3 (Homo sapiens)	1624291	PMID:21282530	RGD	PMID:21282530
Pcgf3	Rat	PcG protein complex	part_of	IEA	UniProtKB:Q3KNV8 and ensembl:ENSP00000354724	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pcgf3	Rat	PcG protein complex	part_of	ISO	Pcgf3 (Mus musculus)	1624291	PMID:28596365	RGD	PMID:28596365
Pcgf3	Rat	PcG protein complex	part_of	IEA	ARBA:ARBA00026510	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Pcgf3	Rat	PRC1 complex	part_of	IBA	PANTHER:PTN000088533 and UniProtKB:Q9BYE7	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pcgf3	Rat	X chromosome	located_in	ISO	Pcgf3 (Mus musculus)	1624291	PMID:28596365	RGD	PMID:28596365

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcgf3	Rat	histone H2AK119 ubiquitin ligase activity	enables	ISO	Pcgf3 (Mus musculus)	1624291	PMID:28596365	RGD	PMID:28596365
Pcgf3	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pcgf3	Rat	protein binding	enables	ISO	PCGF3 (Homo sapiens)	1624291	UniProtKB:O95503 more ...	RGD	PMID:21282530 more ...
Pcgf3	Rat	protein binding	enables	ISO	Pcgf3 (Mus musculus)	1624291	UniProtKB:Q9CQJ4 and PMID:28596365	RGD	PMID:28596365
Pcgf3	Rat	protein binding	enables	ISO	PCGF3 (Homo sapiens) and UniProtKB:Q3KNV8-2	1624291	UniProtKB:P78364 more ...	RGD	PMID:32296183
Pcgf3	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pcgf3	Rat	histone modification pathway		ISO	PCGF3 (Homo sapiens)	9479058		RGD
Pcgf3	Rat	histone modification pathway		ISO	PCGF3 (Homo sapiens)	9479060		RGD

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	PRC1 complex diversity: where is it taking us?	Gil J and O'Loghlen A, Trends Cell Biol. 2014 Jul 22. pii: S0962-8924(14)00102-0. doi: 10.1016/j.tcb.2014.06.005.
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
4.	Comprehensive gene review and curation	RGD comprehensive gene curation
5.	Occupying chromatin: Polycomb mechanisms for getting to genomic targets, stopping transcriptional traffic, and staying put.	Simon JA and Kingston RE, Mol Cell. 2013 Mar 7;49(5):808-24. doi: 10.1016/j.molcel.2013.02.013.

PMID:12477932	PMID:21282530	PMID:28596365

Pcgf3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	1,381,976 - 1,436,709 (-)	NCBI		GRCr8
mRatBN7.2	14	1,237,594 - 1,291,717 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	1,233,947 - 1,291,793 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	1,136,329 - 1,173,467 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	2,438,091 - 2,475,222 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	1,134,803 - 1,171,901 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	2,247,805 - 2,297,155 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	2,247,808 - 2,297,155 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	2,242,206 - 2,295,509 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	1,824,819 - 1,839,263 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	1,784,275 - 1,835,105 (-)	NCBI
Celera	14	1,276,942 - 1,313,583 (-)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

PCGF3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	705,832 - 770,089 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	705,748 - 770,089 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	699,621 - 763,877 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	689,573 - 754,428 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	689,572 - 754,255	NCBI
Celera	4	654,586 - 701,073 (+)	NCBI		Celera
Cytogenetic Map	4	p16.3	NCBI
HuRef	4	674,466 - 735,220 (+)	NCBI		HuRef
CHM1_1	4	699,353 - 761,389 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	4	705,458 - 767,880 (+)	NCBI		T2T-CHM13v2.0

Pcgf3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	108,609,082 - 108,654,842 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	108,609,098 - 108,654,842 (+)	Ensembl		GRCm39 Ensembl
GRCm38	5	108,461,259 - 108,506,976 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	108,461,232 - 108,506,976 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	108,890,351 - 108,932,118 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	108,701,634 - 108,743,401 (+)	NCBI		MGSCv36	mm8
Celera	5	105,582,876 - 105,624,630 (+)	NCBI		Celera
Cytogenetic Map	5	F	NCBI
cM Map	5	53.13	NCBI

Pcgf3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955514	307,332 - 350,039 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955514	307,331 - 350,039 (+)	NCBI	ChiLan1.0	ChiLan1.0

PCGF3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	1,015,288 - 1,086,487 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	973,254 - 1,043,017 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	802,990 - 874,063 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	746,147 - 805,443 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	746,137 - 805,443 (+)	Ensembl	panpan1.1		panPan2

PCGF3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	91,673,424 - 91,708,751 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	91,676,496 - 91,708,754 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	94,138,937 - 94,187,941 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	92,673,047 - 92,722,052 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	92,673,047 - 92,722,019 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	91,844,192 - 91,893,180 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	91,900,171 - 91,949,129 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	92,281,790 - 92,330,796 (-)	NCBI		UU_Cfam_GSD_1.0

Pcgf3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	68,647,474 - 68,671,564 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936477	22,349,171 - 22,373,393 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936477	22,349,166 - 22,373,256 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PCGF3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	140,446 - 182,261 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	140,435 - 189,796 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	80,086 - 128,768 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PCGF3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	27	48,015,976 - 48,077,688 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	48,020,010 - 48,053,520 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666051	4,401,028 - 4,463,055 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pcgf3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624755	26,294,689 - 26,326,318 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624755	26,294,675 - 26,344,864 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Pcgf3
120 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	57
Count of miRNA genes:	51
Interacting mature miRNAs:	52
Transcripts:	ENSRNOT00000000071
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
71115	Niddm15	Non-insulin dependent diabetes mellitus QTL 15	4.8		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1217606	11030812	Rat
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1217606	16960180	Rat

D14Got2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	1,241,910 - 1,242,083 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	2,252,122 - 2,252,294	NCBI	Rnor6.0
Rnor_5.0	14	2,246,750 - 2,246,922	UniSTS	Rnor5.0
RGSC_v3.4	14	1,788,683 - 1,788,856	RGD	RGSC3.4
RGSC_v3.4	14	1,788,684 - 1,788,856	UniSTS	RGSC3.4
RGSC_v3.1	14	1,788,683 - 1,788,856	RGD
Celera	14	1,281,259 - 1,281,431	UniSTS
RH 2.0 Map	14	7.8	RGD
Cytogenetic Map	14	p22	UniSTS

AU049720

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	1,242,240 - 1,242,375 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	2,252,453 - 2,252,587	NCBI	Rnor6.0
Rnor_5.0	14	2,247,081 - 2,247,215	UniSTS	Rnor5.0
RGSC_v3.4	14	1,789,015 - 1,789,149	UniSTS	RGSC3.4
Celera	14	1,281,591 - 1,281,725	UniSTS
Cytogenetic Map	14	p22	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001107245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC106245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC167000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000071 ⟹ ENSRNOP00000000071

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	1,233,947 - 1,291,793 (-)	Ensembl
Rnor_6.0 Ensembl	14	2,247,808 - 2,297,155 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108544 ⟹ ENSRNOP00000084689

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	1,248,150 - 1,291,777 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000111567 ⟹ ENSRNOP00000084631

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	1,233,947 - 1,279,698 (-)	Ensembl

RefSeq Acc Id:

NM_001107245 ⟹ NP_001100715

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	1,381,976 - 1,436,709 (-)	NCBI
mRatBN7.2	14	1,237,594 - 1,291,717 (-)	NCBI
Rnor_6.0	14	2,247,805 - 2,297,155 (-)	NCBI
Rnor_5.0	14	2,242,206 - 2,295,509 (-)	NCBI
RGSC_v3.4	14	1,824,819 - 1,839,263 (-)	RGD
Celera	14	1,276,942 - 1,313,583 (-)	NCBI

Sequence:

show sequence

CTTTGTTTTAAACTCTGCACGGCTTTTTTCTCCTCCTCTTGGGGGGGACCCAGAGGGAGCGGCGCCCCCTCCCCCTCCCGGCGAGCCCCCGCGTGCGCCCGCTCGCCCGCCGCCCGAGACGCAGACTT
CACGATGTAGCCCCGATTCCAGACTGTCATTTACAGAAAATGGAAAAGGAACAAGGGGCAGAAGGAAGGTGCAGAAGCCAGCCAGAACTCAGAGTAAGGAGGGATCATCGCATCCACTTGGTGGCCTG
AAGCCTCCATGCCACCGAGTGAGGAAGGACACGCAGACATCCAGAGGAGAAGCCAAAGATGTTGACCAGGAAGATTAAACTCTGGGACATAAATGCCCACATCACCTGCCGCCTGTGCAGCGGCTACC
TCATCGACGCAACCACAGTGACTGAGTGTTTGCACACATTCTGCAGGAGCTGCCTGGTGAAGTACCTGGAGGAGAACAATACCTGTCCCACCTGCAGAATCGTGATCCATCAGAGCCACCCGTTACAG
TATATCGGTCATGACAGAACCATGCAGGACATTGTTTACAAGCTGGTGCCGGGCCTCCAGGAAGCGGAAATGAGGAAACAGAGGGAGTTCTATCACAAACTGGGCATGGAGGTACCAGGTGACATCAA
GGGGGAGGCGTGCTCAGCAAAACAGCACTTAGATCCCCGCAATGGTGAAACCAAAGCAGACGACAATTCAAATAAAGAGACGGCGGAAGAGAAGCAGGAGGAGGACAACGATTACCACAGGAGTGACG
AGCAGGTGAGCATCTGTCTGGAATGCAACAGCAGCAAACTGCGTGGCCTCAAGCGGAAGTGGATCAGATGCTCAGCCCAAGCAACTGTGCTGCACCTGAAGAAGTTTATCGCCAAGAAGCTTAACCTC
TCCTCCTTCAATGAGCTGGACATCTTATGCAACGAGGAGATCCTGGGCAAGGACCACACTCTGAAGTTTGTGGTTGTTACAAGGTGGAGGTTCAAGAAGGCACCCCTCCTGCTACACTACAGACCCAA
GATGGACTTGCTGTAAGCCCAGCCAGACTCAGCCCACACCCAGCACTCTACATGGCAAAATGTGCTATGGAATGTTGCCTCTGGGTGCCATGCGGACCAGATTTCTGAATAGAGAATATTTATAACTT
TTGTATGAGAGAATCCACTCCCAACAAGACACTACCAGCACGCGTTTACAGAGGATGAAAACACTTCGCAGTTTGCTCGTCTCTGCTCCAGGTCCACAGGCCAGAGAAGAAGTGAAACATTAGCACGT
CCCCACACCACGTCTGACACACAGCACCTCTGCTTGCTTTCCAGGTCTTGAGAGTCTTGAGCGCGTTTCAGTTGAGTTCATGGATTAGGTTTCATGATAAGCCTCAAAAACACTTGTACTTTTATTAA
GTTCTTCGTAAGTTATTGAAAGTCTTTTGATGGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence


Protein RefSeqs	NP_001100715	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI67000	(Get FASTA)	NCBI Sequence Viewer
	EDL84012	(Get FASTA)	NCBI Sequence Viewer
	EDL84013	(Get FASTA)	NCBI Sequence Viewer
	EDL84014	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000071.5
	ENSRNOP00000084631.1
	ENSRNOP00000084689.1

RefSeq Acc Id:

NP_001100715 ⟸ NM_001107245

- UniProtKB:

B2RZ26 (UniProtKB/TrEMBL), F7EV63 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLTRKIKLWDINAHITCRLCSGYLIDATTVTECLHTFCRSCLVKYLEENNTCPTCRIVIHQSHPLQYIGHDRTMQDIVYKLVPGLQEAEMRKQREFYHKLGMEVPGDIKGEACSAKQHLDPRNGETKA
DDNSNKETAEEKQEEDNDYHRSDEQVSICLECNSSKLRGLKRKWIRCSAQATVLHLKKFIAKKLNLSSFNELDILCNEEILGKDHTLKFVVVTRWRFKKAPLLLHYRPKMDLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000000071 ⟸ ENSRNOT00000000071

Ensembl Acc Id:

ENSRNOP00000084631 ⟸ ENSRNOT00000111567

Ensembl Acc Id:

ENSRNOP00000084689 ⟸ ENSRNOT00000108544

Protein Domains

RAWUL RING-type

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2RZ26-F1-model_v2	AlphaFold	B2RZ26	1-241	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13699150

Promoter ID:

EPDNEW_R9674

Type:

initiation region

Name:

Pcgf3_1

Description:

polycomb group ring finger 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	14	2,297,206 - 2,297,266	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-16677	BioCyc
Ensembl Genes	ENSRNOG00000000062	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000071.5	UniProtKB/TrEMBL
	ENSRNOT00000108544.1	UniProtKB/TrEMBL
	ENSRNOT00000111567.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
	Phosphatidylinositol 3-kinase Catalytic Subunit, Chain A, domain 1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9031673	IMAGE-MGC_LOAD
InterPro	PcG_RING_finger	UniProtKB/TrEMBL
	RAWUL	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
KEGG Report	rno:305624	UniProtKB/TrEMBL
MGC_CLONE	MGC:189162	IMAGE-MGC_LOAD
NCBI Gene	305624	ENTREZGENE
PANTHER	POLYCOMB GROUP RING FINGER PROTEIN	UniProtKB/TrEMBL
Pfam	RAWUL	UniProtKB/TrEMBL
	zf-C3HC4_2	UniProtKB/TrEMBL
PhenoGen	Pcgf3	PhenoGen
PROSITE	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000062	RatGTEx
SMART	RING	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
UniProt	A0A8I5ZYD6_RAT	UniProtKB/TrEMBL
	A0A8I6A1U0_RAT	UniProtKB/TrEMBL
	B2RZ26	ENTREZGENE, UniProtKB/TrEMBL
	F7EV63	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Pcgf3	polycomb group ring finger 3	Rnf3_predicted	ring finger protein 3 (predicted)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-01-12	Rnf3_predicted	ring finger protein 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations