Advanced Search (OLGA)

Gene: Rras (RAS related) Rattus norvegicus

Analyze

Symbol:

Rras

Name:

RAS related

RGD ID:

1311443

Description:

Predicted to enable GDP binding activity; GTP binding activity; and GTPase activity. Predicted to be involved in several processes, including face morphogenesis; positive regulation of endothelial cell-matrix adhesion via fibronectin; and regulation of intracellular signal transduction. Predicted to act upstream of or within negative regulation of Schwann cell migration. Predicted to be located in membrane. Predicted to be active in plasma membrane. Orthologous to human RRAS (RAS related); PARTICIPATES IN ephrin - ephrin receptor bidirectional signaling axis; mitogen activated protein kinase signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Harvey rat sarcoma oncogene, subgroup R; Harvey rat sarcoma virus oncogene, subgroup R; LOC361568; p23; ras-related protein R-Ras; Ras-related protein R-RAS (P23); RAS-related viral oncoprotein; related RAS viral (r-ras) oncogene homolog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RRAS (RAS related)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rras (related RAS viral (r-ras) oncogene)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rras (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RRAS (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RRAS (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rras (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RRAS (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RRAS (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rras (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rras (RAS related)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LPO (lactoperoxidase)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RRAS (RAS related)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rras (related RAS viral (r-ras) oncogene)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rras (RAS related)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	rras (RAS related)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	RAS1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ras64B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ras64B	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ras-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ras-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RAS2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rras	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	104,637,061 - 104,640,841 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	104,634,951 - 104,640,841 (+)	Ensembl				GRCr8
mRatBN7.2	1	95,500,582 - 95,504,362 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,500,566 - 95,504,357 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	100,885,980 - 100,889,760 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,358,646 - 109,362,426 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	102,649,041 - 102,652,821 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,012,822 - 101,016,720 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,012,822 - 101,016,720 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	102,077,775 - 102,081,673 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	95,490,730 - 95,495,462 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	89,761,925 - 89,765,705 (+)	NCBI		Celera
RGSC_v3.1	1	95,568,807 - 95,573,563 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

COVID-19 (ISO)

Desbuquois dysplasia (ISO)

Hereditary Neoplastic Syndromes (ISO)

juvenile myelomonocytic leukemia (ISO)

Noonan syndrome (ISO)

Prostatic Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

aconitine (EXP)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-phellandrene (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

butyric acid (ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

chlordecone (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

crocidolite asbestos (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

cytarabine (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dioxygen (ISO)

disulfiram (ISO)

diuron (EXP)

dorsomorphin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

etoposide (ISO)

eugenol (EXP)

ferrosoferric oxide (ISO)

furfural (ISO)

gentamycin (EXP)

glafenine (EXP)

glyphosate (ISO)

hydroxyurea (ISO)

indometacin (ISO)

inulin (ISO)

ivermectin (ISO)

lipopolysaccharide (ISO)

mercury dibromide (ISO)

methotrexate (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (ISO)

p-anisidine (ISO)

paracetamol (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

phenol red (ISO)

potassium chromate (ISO)

propiconazole (ISO)

quercetin (ISO)

raloxifene (ISO)

rotenone (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

sodium chloride (ISO)

sodium fluoride (ISO)

Soman (EXP)

sunitinib (ISO)

temozolomide (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

thalidomide (ISO)

thiram (ISO)

titanium dioxide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vorinostat (ISO)

XL147 (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

establishment or maintenance of cell polarity (IBA)

face morphogenesis (IEA,ISO)

leukocyte differentiation (IEA,ISO)

negative regulation of cell migration (ISO)

positive regulation of angiogenesis (IEA,ISO,ISS)

positive regulation of endothelial cell migration (IEA,ISO)

positive regulation of endothelial cell-matrix adhesion (IEA,ISO)

positive regulation of vasculogenesis (IEA,ISO)

Ras protein signal transduction (IBA)

regulation of ERK1 and ERK2 cascade (IEA,ISO)

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction (IEA,ISO)

signal transduction (IEA)

Cellular Component

membrane (IEA)

plasma membrane (IBA,IEA)

Molecular Function

G protein activity (IEA)

GDP binding (IEA,ISO)

GTP binding (IEA)

GTPase activity (IBA,IEA,ISO)

hydrolase activity (IEA)

nucleotide binding (IEA)

protein binding (IPI,ISO)

protein-containing complex binding (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ephrin - ephrin receptor bidirectional signaling axis (ISO)

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Regulator of G-protein signaling 14 (RGS14) is a selective H-Ras effector.	Willard FS, etal., PLoS One. 2009;4(3):e4884. doi: 10.1371/journal.pone.0004884. Epub 2009 Mar 25.

Additional References at PubMed

PMID:14724565	PMID:15297673	PMID:16773572	PMID:19056867	PMID:21393242	PMID:21423176	PMID:22825554	PMID:23209302	PMID:23376485	PMID:24705357

Genomics

Comparative Map Data

Rras
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	104,637,061 - 104,640,841 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	104,634,951 - 104,640,841 (+)	Ensembl				GRCr8
mRatBN7.2	1	95,500,582 - 95,504,362 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	95,500,566 - 95,504,357 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	100,885,980 - 100,889,760 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	109,358,646 - 109,362,426 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	102,649,041 - 102,652,821 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	101,012,822 - 101,016,720 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	101,012,822 - 101,016,720 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	102,077,775 - 102,081,673 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	95,490,730 - 95,495,462 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	89,761,925 - 89,765,705 (+)	NCBI		Celera
RGSC_v3.1	1	95,568,807 - 95,573,563 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

RRAS
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	49,635,292 - 49,640,143 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	49,635,292 - 49,640,143 (-)	Ensembl			hg38	GRCh38
GRCh37	19	50,138,549 - 50,143,400 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	54,830,364 - 54,835,212 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	19	54,830,363 - 54,835,212	NCBI
Celera	19	47,007,883 - 47,012,731 (-)	NCBI		Celera
Cytogenetic Map	19	q13.33	NCBI
HuRef	19	46,515,612 - 46,520,460 (-)	NCBI		HuRef
CHM1_1	19	50,140,333 - 50,145,181 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	19	52,635,325 - 52,640,178 (-)	NCBI		T2T-CHM13v2.0

Rras
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	44,665,686 - 44,671,070 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	44,667,385 - 44,671,071 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	45,017,942 - 45,021,646 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	45,017,961 - 45,021,647 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	52,273,377 - 52,277,014 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	44,886,049 - 44,889,686 (+)	NCBI		MGSCv36	mm8
Celera	7	40,469,567 - 40,473,202 (+)	NCBI		Celera
Cytogenetic Map	7	B3	NCBI
cM Map	7	29.08	NCBI

Rras
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955559	1,244,658 - 1,248,774 (+)	Ensembl
ChiLan1.0	NW_004955559	1,244,658 - 1,248,774 (+)	NCBI	ChiLan1.0	ChiLan1.0

RRAS
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	55,752,559 - 55,757,421 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	57,673,302 - 57,678,161 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	46,649,892 - 46,654,754 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	19	55,569,465 - 55,571,444 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	19	55,569,749 - 55,573,721 (-)	Ensembl			panPan2	panpan1.1

RRAS
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	106,895,413 - 106,899,265 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	106,895,408 - 106,899,222 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	106,479,192 - 106,483,049 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	107,416,876 - 107,420,728 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	107,416,878 - 107,420,685 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	107,089,085 - 107,092,934 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	106,731,174 - 106,735,018 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	107,572,304 - 107,576,157 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rras
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	21,838,491 - 21,842,354 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936664	3,456,290 - 3,460,788 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936664	3,456,681 - 3,460,537 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RRAS
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	54,680,600 - 54,684,719 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	6	54,680,596 - 54,684,714 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	50,409,620 - 50,413,729 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RRAS
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	42,810,411 - 42,815,504 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	42,810,339 - 42,815,479 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666073	22,754,154 - 22,759,266 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rras
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624832	4,633,326 - 4,637,938 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624832	4,632,812 - 4,637,938 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rras
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	154,522,970 - 154,527,005 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rras
70 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	59
Count of miRNA genes:	55
Interacting mature miRNAs:	59
Transcripts:	ENSRNOT00000027809
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
2300324	Fetw1	Fetal weight QTL 1	12.1	0.005	fetal growth trait (VT:0004201)	fetal body weight (CMO:0002080)	1	92963855	109494029	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	66404680	111404680	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
1549903	Bp267	Blood pressure QTL 267			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	84107164	115183752	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	66077886	111077886	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
152025249	Scl82	Serum cholesterol level QTL 82	4.77		blood cholesterol amount (VT:0000180)		1	52891222	109116986	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	97582336	142582336	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat

Markers in Region

Rras

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	1	104,640,630 - 104,640,761 (+)	Marker Load Pipeline
mRatBN7.2	1	95,504,151 - 95,504,283 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	101,016,510 - 101,016,641	NCBI	Rnor6.0
Rnor_5.0	1	102,081,463 - 102,081,594	UniSTS	Rnor5.0
RGSC_v3.4	1	95,495,252 - 95,495,383	UniSTS	RGSC3.4
Celera	1	89,765,495 - 89,765,626	UniSTS
Cytogenetic Map	1	q22	UniSTS

AI573426

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	95,504,077 - 95,504,195 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	101,016,436 - 101,016,553	NCBI	Rnor6.0
Rnor_5.0	1	102,081,389 - 102,081,506	UniSTS	Rnor5.0
RGSC_v3.4	1	95,495,178 - 95,495,295	UniSTS	RGSC3.4
Celera	1	89,765,421 - 89,765,538	UniSTS
Cytogenetic Map	1	q22	UniSTS

BF403987

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	95,501,045 - 95,501,188 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	101,013,286 - 101,013,428	NCBI	Rnor6.0
Rnor_5.0	1	102,078,239 - 102,078,381	UniSTS	Rnor5.0
RGSC_v3.4	1	95,491,194 - 95,491,335	UniSTS	RGSC3.4
Celera	1	89,762,389 - 89,762,531	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001108481	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082165	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MW394779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000027809 ⟹ ENSRNOP00000027809

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	104,634,951 - 104,640,841 (+)	Ensembl
mRatBN7.2 Ensembl	1	95,500,566 - 95,504,357 (+)	Ensembl
Rnor_6.0 Ensembl	1	101,012,822 - 101,016,720 (+)	Ensembl

RefSeq Acc Id:

NM_001108481 ⟹ NP_001101951

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	104,637,061 - 104,640,841 (+)	NCBI
mRatBN7.2	1	95,500,582 - 95,504,362 (+)	NCBI
Rnor_6.0	1	101,012,822 - 101,016,720 (+)	NCBI
Rnor_5.0	1	102,077,775 - 102,081,673 (+)	NCBI
RGSC_v3.4	1	95,490,730 - 95,495,462 (+)	RGD
Celera	1	89,761,925 - 89,765,705 (+)	RGD

Sequence:

show sequence

GCGGTGGCGACATGAGCAGCGGGGCGGCGTCCGGGACTGGGCGGGGGCGGCCCCGGGGCGGGGG
GCCGGGACCCAGGGACCCCCCGCCCGGCGAGACTCACAAGCTGGTGGTCGTAGGCGGCGGCGGC
GTGGGCAAGAGCGCGCTGACCATCCAGTTCATCCAGTCCTACTTTGTGTCTGACTATGACCCCA
CCATTGAGGATTCCTACACAAAGATCTGCACGGTGGACGGCATCCCTGCACGGCTGGACATCCT
GGACACTGCGGGGCAAGAGGAATTCGGCGCCATGCGGGAGCAGTACATGCGTGCTGGCAATGGC
TTCTTGCTGGTGTTTGCCATTAACGACAGGCAGAGTTTCATTGAAGTAAGCAAGCTCTTCACTC
AGATCCTCAGGGTCAAGGACCGCGATGACTTCCCCATTGTGCTGGTTGGGAACAAGGCAGATCT
GGAGACACAGCGCCAGGTCCTTCGATCAGAGGCCTCCTCCTTTAGTGCTTCCCACCATATGACT
TACTTTGAGGCCTCAGCCAAACTGCGTCTAAATGTCGATGAGGCATTTGAGCAGCTGGTGCGGA
CTGTCCGGAAATACCAGGAGCAAGAACTCCCTCCTAGCCCACCCAGTGCCCCTAGGAAGAAGGA
TGGGAGGTGCCCCTGTGTCCTGCTGTAGCCTCAAGTGACCAGCACAAGCTCTCGGGACCAGCTG
CCTCACACTTGCTGTGTGGCCCAAGGCTCTCTCTGACTGAGCCTCTGTTTCAACCTCTGGGTTC
CCCAGGACACACTACACCCTCTTACCTTTACTTCTGGCCTCCTGGGGCTACCACCATGTGCCTT
CTGTCAATACCTCCTCCTTTCCCCCACAAGACCCTGGTAGGGTGAGGGGCATCTTGTCACTGCT
GTATATAACTCCCATCTGTCAGTATAATAAATATCACTGCCAACAACTGAAGAC

hide sequence

RefSeq Acc Id:

XM_039082165 ⟹ XP_038938093

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	104,637,313 - 104,640,838 (+)	NCBI
mRatBN7.2	1	95,500,835 - 95,504,359 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001101951	(Get FASTA)	NCBI Sequence Viewer
	XP_038938093	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3Z8L7	(Get FASTA)	NCBI Sequence Viewer
	EDM07427	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000027809
	ENSRNOP00000027809.4
GenBank Protein	QST76895	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001101951 ⟸ NM_001108481

- UniProtKB:

D3Z8L7 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSSGAASGTGRGRPRGGGPGPRDPPPGETHKLVVVGGGGVGKSALTIQFIQSYFVSDYDPTIED
SYTKICTVDGIPARLDILDTAGQEEFGAMREQYMRAGNGFLLVFAINDRQSFIEVSKLFTQILR
VKDRDDFPIVLVGNKADLETQRQVLRSEASSFSASHHMTYFEASAKLRLNVDEAFEQLVRTVRK
YQEQELPPSPPSAPRKKDGRCPCVLL

hide sequence

Ensembl Acc Id:

ENSRNOP00000027809 ⟸ ENSRNOT00000027809

RefSeq Acc Id:	XP_038938093 ⟸ XM_039082165
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3Z8L7-F1-model_v2	AlphaFold	D3Z8L7	1-218	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690018

Promoter ID:

EPDNEW_R543

Type:

initiation region

Name:

Rras_1

Description:

RAS related

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	101,012,803 - 101,012,863	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1311443	AgrOrtholog
BioCyc Gene	G2FUF-59733	BioCyc
Ensembl Genes	ENSRNOG00000037247	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000027809	ENTREZGENE
	ENSRNOT00000027809.8	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.300	UniProtKB/Swiss-Prot
InterPro	P-loop_NTPase	UniProtKB/Swiss-Prot
	Small_GTP-bd_dom	UniProtKB/Swiss-Prot
	Small_GTPase	UniProtKB/Swiss-Prot
	Small_GTPase_Ras-type	UniProtKB/Swiss-Prot
KEGG Report	rno:361568	UniProtKB/Swiss-Prot
NCBI Gene	361568	ENTREZGENE
PANTHER	PTHR24070	UniProtKB/Swiss-Prot
Pfam	Ras	UniProtKB/Swiss-Prot
PhenoGen	Rras	PhenoGen
PRINTS	RASTRNSFRMNG	UniProtKB/Swiss-Prot
PROSITE	RAS	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000037247	RatGTEx
SMART	RAB	UniProtKB/Swiss-Prot
	RAN	UniProtKB/Swiss-Prot
	RAS	UniProtKB/Swiss-Prot
	RHO	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A0A8A1U964_RAT	UniProtKB/TrEMBL
	A0A8A1UA40_RAT	UniProtKB/TrEMBL
	A0A8A1UAN5_RAT	UniProtKB/TrEMBL
	A0A8A1UBD2_RAT	UniProtKB/TrEMBL
	A0A8A1UBN5_RAT	UniProtKB/TrEMBL
	D3Z8L7	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-08-16	Rras	RAS related	Rras	related RAS viral (r-ras) oncogene homolog	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-09-29	Rras	related RAS viral (r-ras) oncogene homolog	Rras	Harvey rat sarcoma virus oncogene, subgroup R	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-11-20	Rras	Harvey rat sarcoma virus oncogene, subgroup R	Rras	Harvey rat sarcoma oncogene, subgroup R	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Rras	Harvey rat sarcoma oncogene, subgroup R	Rras_predicted	Harvey rat sarcoma oncogene, subgroup R (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Rras_predicted	Harvey rat sarcoma oncogene, subgroup R (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)