Advanced Search (OLGA)

Gene: Ndn (necdin, MAGE family member) Rattus norvegicus

Analyze

Symbol:

Ndn

Name:

necdin, MAGE family member

RGD ID:

1310526

Description:

Predicted to enable gamma-tubulin binding activity and promoter-specific chromatin binding activity. Predicted to be involved in negative regulation of transcription by RNA polymerase II. Predicted to act upstream of or within several processes, including nervous system development; neurotrophin TRK receptor signaling pathway; and regulation of gene expression. Predicted to be located in cell projection; centrosome; and cytosol. Predicted to be part of protein-containing complex. Predicted to be active in nucleus. Human ortholog(s) of this gene implicated in Prader-Willi syndrome. Orthologous to human NDN (necdin, MAGE family member); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

MGC105768; necdin; necdin homolog; necdin homolog (mouse); necdin, melanoma antigen (MAGE) family member

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NDN (necdin, MAGE family member)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ndn (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ndn (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NDN (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NDN (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ndn (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NDN (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NDN (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ndn (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ndn (necdin, MAGE family member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	NDN (necdin, MAGE family member)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NDN (necdin, MAGE family member)	Alliance	DIOPT (Ensembl Compara\|HGNC\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ndn (necdin, MAGE family member)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ndnl2 (necdin-like 2)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	MAGE	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	MAGE	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NSE3	Alliance	DIOPT (Hieranoid\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	nsmce3	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	125,261,059 - 125,262,658 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	125,260,997 - 125,262,785 (+)	Ensembl				GRCr8
mRatBN7.2	1	115,849,168 - 115,850,767 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	115,849,105 - 115,850,767 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	123,796,017 - 123,797,616 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	130,978,517 - 130,980,116 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	123,804,265 - 123,805,864 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	122,981,755 - 122,983,354 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	122,981,755 - 122,983,351 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	124,119,141 - 124,120,740 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	116,594,603 - 116,596,202 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	108,120,324 - 108,121,923 (+)	NCBI		Celera
RGSC_v3.1	1	116,672,945 - 116,674,545 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

autistic disorder (ISO)

Birth Weight (ISO)

carcinoma (ISO)

Prader-Willi syndrome (ISO,ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1-dichloroethene (ISO)

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-hydroperoxycyclophosphamide (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium atom (ISO)

CGP 52608 (ISO)

chlorpyrifos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

diazinon (EXP)

dibutyl phthalate (ISO)

dieldrin (EXP)

diethyl phthalate (ISO)

diethylstilbestrol (EXP)

diisobutyl phthalate (ISO)

diisononyl phthalate (ISO)

diuron (EXP)

doxorubicin (ISO)

ethanol (ISO)

indometacin (ISO)

methimazole (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

N-ethyl-N-nitrosourea (ISO)

nitric oxide (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctanoic acid (EXP)

PhIP (EXP)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO)

silicon dioxide (EXP)

sodium fluoride (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

axon extension (ISO)

axonal fasciculation (ISO)

axonogenesis (ISO)

central nervous system development (ISO)

genomic imprinting (ISO)

glial cell migration (ISO)

multicellular organismal-level homeostasis (ISO)

negative regulation of transcription by RNA polymerase II (IBA,ISO)

neuron development (ISO)

neuron differentiation (ISO)

neuron migration (ISO)

neurotrophin TRK receptor signaling pathway (ISO,NAS)

obsolete negative regulation of DNA-binding transcription factor activity (ISO)

positive regulation of protein deacetylation (ISO)

positive regulation of transcription by RNA polymerase II (ISO)

post-embryonic development (ISO)

regulation of DNA-templated transcription (ISO)

respiratory gaseous exchange by respiratory system (ISO)

respiratory system process (ISO)

sensory perception of pain (ISO)

Cellular Component

cell projection (IEA,ISO)

centrosome (IEA,ISO)

cytoplasm (IEA,ISO)

cytosol (IEA,ISO)

nucleus (IBA,IEA,ISO)

protein-containing complex (IEA,ISO)

Molecular Function

gamma-tubulin binding (IEA,ISO)

promoter-specific chromatin binding (IEA,ISO)

protein binding (IPI,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Nogo-A inhibits necdin-accelerated neurite outgrowth by retaining necdin in the cytoplasm.	Liu X, etal., Mol Cell Neurosci. 2009 May;41(1):51-61. Epub 2009 Feb 6.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	The human chromosomal gene for necdin, a neuronal growth suppressor, in the Prader-Willi syndrome deletion region.	Nakada Y, etal., Gene. 1998 Jun 15;213(1-2):65-72.
6.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	The p75 neurotrophin receptor interacts with multiple MAGE proteins.	Tcherpakov M, etal., J Biol Chem 2002 Dec 20;277(51):49101-4.

Additional References at PubMed

PMID:10508517	PMID:10965153	PMID:12477932	PMID:12629158	PMID:14593116	PMID:15649943	PMID:15972963	PMID:16049186	PMID:19818769	PMID:20220004	PMID:20663865	PMID:21150695
PMID:22442722	PMID:24349431

Genomics

Comparative Map Data

Ndn
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	125,261,059 - 125,262,658 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	125,260,997 - 125,262,785 (+)	Ensembl				GRCr8
mRatBN7.2	1	115,849,168 - 115,850,767 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	115,849,105 - 115,850,767 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	123,796,017 - 123,797,616 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	130,978,517 - 130,980,116 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	123,804,265 - 123,805,864 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	122,981,755 - 122,983,354 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	122,981,755 - 122,983,351 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	124,119,141 - 124,120,740 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	116,594,603 - 116,596,202 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	108,120,324 - 108,121,923 (+)	NCBI		Celera
RGSC_v3.1	1	116,672,945 - 116,674,545 (+)	NCBI
Cytogenetic Map	1	q22	NCBI

NDN
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	23,685,400 - 23,687,305 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	23,685,400 - 23,687,305 (-)	Ensembl			hg38	GRCh38
GRCh37	15	23,930,547 - 23,932,452 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	21,481,647 - 21,483,543 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	15	21,481,646 - 21,483,543	NCBI
Celera	15	2,091,460 - 2,093,348 (-)	NCBI		Celera
Cytogenetic Map	15	q11.2	NCBI
HuRef	15	2,066,175 - 2,068,071 (-)	NCBI		HuRef
CHM1_1	15	23,880,849 - 23,882,745 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	21,419,888 - 21,421,793 (-)	NCBI		T2T-CHM13v2.0

Ndn
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	61,998,025 - 61,999,676 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	61,996,317 - 62,000,010 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	7	62,348,277 - 62,349,928 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	62,346,569 - 62,350,262 (+)	Ensembl			mm10	GRCm38
MGSCv37	7	69,493,163 - 69,494,814 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	7	62,227,298 - 62,228,878 (+)	NCBI		MGSCv36	mm8
MGSCv36	7	51,709,553 - 51,711,133 (+)	NCBI		MGSCv36	mm8
Cytogenetic Map	7	C	NCBI
cM Map	7	34.36	NCBI

Ndn
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	31,125,924 - 31,126,889 (-)	Ensembl
ChiLan1.0	NW_004955416	31,125,354 - 31,127,010 (-)	NCBI	ChiLan1.0	ChiLan1.0

NDN
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	11,419,144 - 11,420,810 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	14,994,194 - 14,995,858 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	5,977,519 - 5,979,185 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	21,176,270 - 21,177,467 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2

NDN
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	36,313,977 - 36,315,661 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	36,314,104 - 36,315,081 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	38,977,703 - 38,979,382 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	36,703,979 - 36,705,659 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	36,703,985 - 36,705,961 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	36,210,187 - 36,211,865 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	36,473,293 - 36,474,972 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	36,617,808 - 36,619,491 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ndn
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	124,509,175 - 124,510,858 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936805	849,345 - 850,322 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936805	849,218 - 850,894 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NDN
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	142,412,565 - 142,414,240 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	1	142,412,688 - 142,413,665 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	158,275,444 - 158,276,423 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NDN
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	57,939,212 - 57,940,868 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	57,939,330 - 57,940,295 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666054	40,938,673 - 40,940,350 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ndn
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624768	579,607 - 581,302 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ndn
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	137,595,414 - 137,597,068 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ndn
13 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	90
Count of miRNA genes:	70
Interacting mature miRNAs:	86
Transcripts:	ENSRNOT00000013468
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	176289080	Rat
1582234	Gluco18	Glucose level QTL 18	3.4	0.0003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	87889942	132889942	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	51941022	208479811	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	39728272	132889942	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	102780511	182384005	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	51940904	168768703	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	101228864	146228864	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	111949780	210707719	Rat
1331800	Scl25	Serum cholesterol level QTL 25	3.013		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	1	87785026	142582336	Rat
631684	Bp117	Blood pressure QTL 117	8.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	120082258	165082258	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	83019780	128019780	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	112521556	157521556	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34184556	172281316	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	66009857	160501508	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	34565911	208798288	Rat
631519	Pia11	Pristane induced arthritis QTL 11	5.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	93903998	191260518	Rat
1302788	Scl19	Serum cholesterol QTL 19	4.6	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	66400974	132889942	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	108680016	153680016	Rat
631569	Bp93	Blood pressure QTL 93		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	115183611	131244255	Rat
2313083	Bmd74	Bone mineral density QTL 74	4	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	91302413	136302413	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	51511344	153680016	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	102359314	153680016	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	99645382	182701046	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	99645382	221502378	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	111949780	210707719	Rat
1358192	Ept13	Estrogen-induced pituitary tumorigenesis QTL 13	3.4		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	1	86622262	131622262	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	109493780	193400781	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	112521556	157521556	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	124975316	152612788	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	103779152	223964440	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	111949780	160574007	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	98879955	208479939	Rat
738022	Anxrr13	Anxiety related response QTL 13	4.6	0.00039	locomotor behavior trait (VT:0001392)	measurement of voluntary locomotion into, out of, or within a discrete space in an open field apparatus (CMO:0001514)	1	92683681	137683681	Rat
10054135	Gmadr2	Adrenal mass QTL 2	1.97	0.0129	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	86993904	131993904	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	110389869	155389869	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	92683681	137683681	Rat
7411712	Strs4	Sensitivity to stroke QTL 4	8.7		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	1	87558587	132558587	Rat
737977	Bp160	Blood pressure QTL 160		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	97582336	142582336	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	116099376	191260518	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	101594089	146594089	Rat
61433	Cia2	Collagen induced arthritis QTL 2	5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	100345976	145345976	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	96717367	160111531	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	111949780	228180370	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	111404407	142582336	Rat

Markers in Region

AI528698

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	115,850,559 - 115,850,651 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	122,983,147 - 122,983,238	NCBI	Rnor6.0
Rnor_5.0	1	124,120,533 - 124,120,624	UniSTS	Rnor5.0
RGSC_v3.4	1	116,595,995 - 116,596,086	UniSTS	RGSC3.4
Celera	1	108,121,716 - 108,121,807	UniSTS
Cytogenetic Map	1	q22	UniSTS

Ndn

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	115,849,562 - 115,850,509 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	122,982,150 - 122,983,096	NCBI	Rnor6.0
Rnor_5.0	1	124,119,536 - 124,120,482	UniSTS	Rnor5.0
RGSC_v3.4	1	116,594,998 - 116,595,944	UniSTS	RGSC3.4
Celera	1	108,120,719 - 108,121,665	UniSTS
Cytogenetic Map	1	q22	UniSTS

Ndn

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	115,849,480 - 115,849,859 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	122,982,068 - 122,982,446	NCBI	Rnor6.0
Rnor_5.0	1	124,119,454 - 124,119,832	UniSTS	Rnor5.0
Celera	1	108,120,637 - 108,121,015	UniSTS
Cytogenetic Map	1	q22	UniSTS

Ndn

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	115,849,480 - 115,850,752 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	122,982,068 - 122,983,339	NCBI	Rnor6.0
Rnor_5.0	1	124,119,454 - 124,120,725	UniSTS	Rnor5.0
Celera	1	108,120,637 - 108,121,908	UniSTS
Cytogenetic Map	1	q22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
15	12	67	163	91	90	59	58	59	6	311	158	11	142	71	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001008558	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC087630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013468 ⟹ ENSRNOP00000013464

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	125,260,997 - 125,262,785 (+)	Ensembl
mRatBN7.2 Ensembl	1	115,849,105 - 115,850,767 (+)	Ensembl
Rnor_6.0 Ensembl	1	122,981,755 - 122,983,351 (+)	Ensembl

RefSeq Acc Id:

NM_001008558 ⟹ NP_001008558

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	125,261,059 - 125,262,658 (+)	NCBI
mRatBN7.2	1	115,849,168 - 115,850,767 (+)	NCBI
Rnor_6.0	1	122,981,755 - 122,983,354 (+)	NCBI
Rnor_5.0	1	124,119,141 - 124,120,740 (+)	NCBI
RGSC_v3.4	1	116,594,603 - 116,596,202 (+)	RGD
Celera	1	108,120,324 - 108,121,923 (+)	RGD

Sequence:

show sequence

CACTGAGGCAGTGCAGGCTCCGAGAGCTCCGAGTCGCAGCGGTCCTGCTCTGATCAAAAGACGC
AGAATGTCGGAACAAAGTAAGGACCTGAGCGACCCTAACTTTGCCGCTGAGGACCCCGACACTG
AGATGCAGGTCAGCGATGCTGTTCCGGTGGGGGTCCCTCCTCCCGCTCCTCTGGCCGCGAACCT
CTCAGGGCCATCGTGCGCTCCGGAAGGCCCTATGGCAGCCCCACAGGCCTCGCCACCACCTGCA
GAACGGTTTGAAGAGGTTGACCCTAAGATCCTGCAGCAGGCCGCAGAAGAGGGCCGCGCCCACC
AGCCCCAGAGCCCAGCCCGGCCGATCCCAGCACCGCCGGCCCCTGCCCAGCTGGTGCAGAAGGC
GCACGAGCTCATGTGGTACGTGTTGGTCAAGGACCAGAAGAGGATGGTCCTCTGGCTTCCAGAC
ATGGTGAAAGAGGTCATGGGCAGCTACAAGAAGTGGTGCAGAAGCATCCTCAGGCGCACCAGCG
TCATCCTCGCCAGAGTTTTCGGGCTGCACCTGAGGCTGACCAATCTCCACACCATGGAGTTCGC
CCTGGTCAAAGCACTCAGCCCAGAAGAGCTGGACAGAGTCGCGCTGAACAACCGTATGCCCATG
ACAGGTCTCCTGCTCATGATCCTGAGTCTCATCTATGTGAAGGGCCGCGGGGCCAGAGAGGGTG
CGGTCTGGAATGTGCTGCGCATCCTGGGGCTGAGGCCCTGGAAGAAGCACTCCACCTTCGGAGA
TGTGAGAAAGATTATCACCGAGGAGTTCGTCCAGCAGAATTACCTGAAGTACCAGCGTGTGCCC
CACATCGAGCCTCCCGAGTACGAGTTCTTCTGGGGCCCCAGAGCTAACCGTGAAATCACCAAGA
TGCAGATCATGGAGTTCCTGGCCAGAGTCTTTAAGAAGGATCCCCAGGCTTGGCCTTCCCGCTA
CAGAGAGGCTCTGGAGCAGGCCAGAGCTCTGCGGGAGGCTAATCTTGTCGCCCAGGCCCCCCGC
AGCAGTGTCTCTGAGGACTAAAATGTCCAGGAGCACATTGATAGTTTCTGACCCATACTAGGGC
TGTGTAAGGGTGGGGTTGGACATTAGAGTATCCCAGATTCATAGTGCAGTATTTCATGTATAGT
TTTTAAGTTTTCCATCCAGTGCTTTTTTTATCTTGTAATGCAATGTATTCAGTTGTGTACTCGT
GTAGTGTTTAAAATTGATGCATGTGTGTTTTATAAGTGAGCAAGTTGGTACTTTCACTTCTGTG
CTTTCTTGGATTTTTGTACAAGAGATGTGCTGTGCTAAACTTGTGAAATACATTGAGGTGTTCT
GTATCTTGTTCTTTGAATGGGACTGATGGTCCGTATCGACAAAGAAGGCCCTGGAGAGTTAGCA
GGACTTAACAACAACACAGACCTGACCAAGAGAAAGGTCAGGGTCCCTCTCCATATGACTCCAA
CTGGCACAGGAAACATCCATGTGGAATGGACTGATTTGAACTGGACTGTTTTCAGTTTAAGCAC
TTAGCACACTTTGCAAAACATGTATCCAACCCCACCATAAATAAACTTTAAAATGAGCATTAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001008558	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH87630	(Get FASTA)	NCBI Sequence Viewer
	EDM08368	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013464.4

RefSeq Acc Id:

NP_001008558 ⟸ NM_001008558

- UniProtKB:

G3V7A4 (UniProtKB/TrEMBL), A6JBJ1 (UniProtKB/TrEMBL), Q5PPL0 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSEQSKDLSDPNFAAEDPDTEMQVSDAVPVGVPPPAPLAANLSGPSCAPEGPMAAPQASPPPAE
RFEEVDPKILQQAAEEGRAHQPQSPARPIPAPPAPAQLVQKAHELMWYVLVKDQKRMVLWLPDM
VKEVMGSYKKWCRSILRRTSVILARVFGLHLRLTNLHTMEFALVKALSPEELDRVALNNRMPMT
GLLLMILSLIYVKGRGAREGAVWNVLRILGLRPWKKHSTFGDVRKIITEEFVQQNYLKYQRVPH
IEPPEYEFFWGPRANREITKMQIMEFLARVFKKDPQAWPSRYREALEQARALREANLVAQAPRS
SVSED

hide sequence

Ensembl Acc Id:

ENSRNOP00000013464 ⟸ ENSRNOT00000013468

Protein Domains

MAGE

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-G3V7A4-F1-model_v2	AlphaFold	G3V7A4	1-325	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690090

Promoter ID:

EPDNEW_R615

Type:

multiple initiation site

Name:

Ndn_1

Description:

necdin, MAGE family member

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	122,981,735 - 122,981,795	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310526	AgrOrtholog
BioCyc Gene	G2FUF-59118	BioCyc
Ensembl Genes	ENSRNOG00000010146	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000013468.8	UniProtKB/TrEMBL
Gene3D-CATH	1.10.10.1200	UniProtKB/TrEMBL
	1.10.10.1210	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7319134	IMAGE-MGC_LOAD
InterPro	MAGE	UniProtKB/TrEMBL
	MAGE	UniProtKB/TrEMBL
	MAGE_WH1	UniProtKB/TrEMBL
	MAGE_WH2	UniProtKB/TrEMBL
KEGG Report	rno:308690	UniProtKB/TrEMBL
MGC_CLONE	MGC:105768	IMAGE-MGC_LOAD
NCBI Gene	308690	ENTREZGENE
PANTHER	PTHR11736	UniProtKB/TrEMBL
	PTHR11736:SF10	UniProtKB/TrEMBL
Pfam	MAGE	UniProtKB/TrEMBL
PhenoGen	Ndn	PhenoGen
PROSITE	MAGE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000010146	RatGTEx
SMART	MAGE	UniProtKB/TrEMBL
UniProt	A6JBJ1	ENTREZGENE, UniProtKB/TrEMBL
	G3V7A4	ENTREZGENE, UniProtKB/TrEMBL
	Q5PPL0	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-12-10	Ndn	necdin, MAGE family member	Ndn	necdin, melanoma antigen (MAGE) family member	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-12-18	Ndn	necdin, melanoma antigen (MAGE) family member	Ndn	necdin homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-09	Ndn	necdin homolog (mouse)	Ndn	necdin	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Ndn	necdin	Ndn_predicted	necdin (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Ndn_predicted	necdin (predicted)			Symbol and Name status set to approved	70820	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_mutations_overexpression	ectopic expression of Mageh1 in PC-12 cells caused an acceleration of NGF-induced neuronal differentiation, possibly through synergy between Nectin-Ngfr signaling and a TrkA signaling pathway	729117

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI