Advanced Search (OLGA)

Gene: Rpp40 (ribonuclease P/MRP subunit p40) Rattus norvegicus

Analyze

Symbol:

Rpp40

Name:

ribonuclease P/MRP subunit p40

RGD ID:

1310228

Description:

Predicted to enable ribonuclease P RNA binding activity. Predicted to contribute to ribonuclease MRP activity and ribonuclease P activity. Predicted to be involved in endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) and tRNA 5'-leader removal. Predicted to be located in nucleolus. Predicted to be part of multimeric ribonuclease P complex and ribonuclease MRP complex. Orthologous to human RPP40 (ribonuclease P/MRP subunit p40); PARTICIPATES IN tRNA maturation pathway; ribosome biogenesis pathway; RNA transport pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC291071; MGC108849; ribonuclease P 40 subunit; ribonuclease P 40 subunit (human); ribonuclease P protein subunit p40; ribonuclease P/MRP 40 subunit; RNaseP protein p40

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPP40 (ribonuclease P/MRP subunit p40)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Rpp40 (ribonuclease P 40 subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpp40 (ribonuclease P/MRP subunit p40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPP40 (ribonuclease P/MRP subunit p40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPP40 (ribonuclease P/MRP subunit p40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpp40 (ribonuclease P/MRP subunit p40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPP40 (ribonuclease P/MRP subunit p40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPP40 (ribonuclease P/MRP subunit p40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpp40 (ribonuclease P/MRP subunit p40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Rpp40 (ribonuclease P/MRP subunit p40)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	RPP40 (ribonuclease P/MRP subunit p40)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rpp40 (ribonuclease P 40 subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpp40 (ribonuclease P/MRP 40 subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	rpp40	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	29,153,203 - 29,162,241 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	29,153,180 - 29,162,241 (+)	Ensembl				GRCr8
mRatBN7.2	17	28,947,752 - 28,956,788 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	28,947,734 - 28,956,788 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	28,807,889 - 28,816,921 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	30,411,435 - 30,420,467 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	28,783,409 - 28,792,437 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	29,638,647 - 29,647,709 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	29,638,677 - 29,647,763 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	31,534,547 - 31,543,593 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	35,249,263 - 35,257,891 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	28,549,277 - 28,557,686 (+)	NCBI		Celera
RGSC_v3.1	17	35,252,103 - 35,260,731 (+)	NCBI
Cytogenetic Map	17	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

all-trans-retinoic acid (ISO)

arsane (ISO)

arsenic atom (ISO)

Benoxacor (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

copper atom (ISO)

copper(0) (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

deguelin (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

fulvestrant (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

isotretinoin (ISO)

lead diacetate (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

nickel atom (ISO)

okadaic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

quercetin (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

T-2 toxin (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

tunicamycin (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) (IBA)

rRNA processing (IEA)

tRNA 5'-leader removal (IBA,IEA,ISO,ISS)

tRNA processing (IEA)

Cellular Component

multimeric ribonuclease P complex (IBA,IEA,ISO,ISS)

nucleolus (IEA)

ribonuclease MRP complex (IBA)

ribonuclease P complex (IEA)

Molecular Function

protein binding (ISO)

ribonuclease MRP activity (IBA)

ribonuclease P activity (IBA,IEA,ISO)

ribonuclease P RNA binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (IEA)

RNA transport pathway (IEA)

tRNA maturation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Unexpected diversity of RNase P, an ancient tRNA processing enzyme: challenges and prospects.	Lai LB, etal., FEBS Lett. 2010 Jan 21;584(2):287-96. doi: 10.1016/j.febslet.2009.11.048. Epub .
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:30454648

Genomics

Comparative Map Data

Rpp40
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	29,153,203 - 29,162,241 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	17	29,153,180 - 29,162,241 (+)	Ensembl				GRCr8
mRatBN7.2	17	28,947,752 - 28,956,788 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	28,947,734 - 28,956,788 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	17	28,807,889 - 28,816,921 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	30,411,435 - 30,420,467 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	28,783,409 - 28,792,437 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	29,638,647 - 29,647,709 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	29,638,677 - 29,647,763 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	17	31,534,547 - 31,543,593 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	17	35,249,263 - 35,257,891 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	17	28,549,277 - 28,557,686 (+)	NCBI		Celera
RGSC_v3.1	17	35,252,103 - 35,260,731 (+)	NCBI
Cytogenetic Map	17	p12	NCBI

RPP40
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	4,988,426 - 5,004,037 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	4,994,717 - 5,004,063 (-)	Ensembl			hg38	GRCh38
GRCh37	6	4,994,951 - 5,004,271 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	4,940,279 - 4,949,270 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	4,940,279 - 4,949,270	NCBI
Celera	6	6,224,004 - 6,232,997 (-)	NCBI		Celera
Cytogenetic Map	6	p25.1	NCBI
HuRef	6	4,871,613 - 4,880,606 (-)	NCBI		HuRef
CHM1_1	6	4,997,633 - 5,006,608 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	4,855,789 - 4,873,023 (-)	NCBI		T2T-CHM13v2.0

Rpp40
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	36,080,685 - 36,095,548 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	36,077,455 - 36,090,342 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	13	35,895,104 - 35,911,565 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	35,893,472 - 35,906,359 (-)	Ensembl			mm10	GRCm38
MGSCv37	13	35,986,973 - 35,998,216 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	13	35,900,937 - 35,913,812 (-)	NCBI		MGSCv36	mm8
Celera	13	37,009,759 - 37,021,002 (-)	NCBI		Celera
Cytogenetic Map	13	A3.3	NCBI
cM Map	13	14.44	NCBI

Rpp40
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955465	8,540,459 - 8,550,249 (+)	Ensembl
ChiLan1.0	NW_004955465	8,540,500 - 8,550,255 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPP40
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	19,623,806 - 19,632,422 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	15,627,775 - 15,636,370 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	4,828,155 - 4,838,680 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	5,015,953 - 5,024,540 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	5,015,953 - 5,024,540 (-)	Ensembl			panPan2	panpan1.1

RPP40
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	5,109,324 - 5,119,713 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	5,109,658 - 5,120,294 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	5,118,469 - 5,128,320 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	5,181,170 - 5,191,232 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	5,181,173 - 5,191,799 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	5,046,009 - 5,056,067 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	5,071,013 - 5,081,115 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	6,403,016 - 6,413,078 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Rpp40
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	19,202,211 - 19,211,477 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936534	7,471,198 - 7,480,475 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936534	7,471,209 - 7,480,457 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPP40
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	2,987,271 - 3,005,271 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	2,990,405 - 3,042,423 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

RPP40
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	67,172,759 - 67,181,669 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	67,173,130 - 67,181,975 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666044	4,945,666 - 4,954,176 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpp40
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	20,233,664 - 20,243,598 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624756	20,233,659 - 20,242,733 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Rpp40
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	14	54,535,327 - 54,544,272 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Rpp40
76 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	54
Interacting mature miRNAs:	54
Transcripts:	ENSRNOT00000021877, ENSRNOT00000068617
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	43999106	Rat
2300002	Iddm36	Insulin dependent diabetes mellitus QTL 36	1.98		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	17	9266755	40968173	Rat
8552966	Pigfal18	Plasma insulin-like growth factor 1 level QTL 18	8.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	12860942	57860942	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
1300123	Bp194	Blood pressure QTL 194	2.82		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	2120843	42054133	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	6221998	58177198	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22660799	55604694	Rat
9589151	Insul30	Insulin level QTL 30	8.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	12860942	57860942	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21498994	50592236	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27233445	83975845	Rat
10401807	Kidm52	Kidney mass QTL 52			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	17	1	31706603	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4733534	49733534	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23286322	64246472	Rat
9589057	Scfw6	Subcutaneous fat weight QTL 6	8.62	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	17	12860942	57860942	Rat
2317045	Aia11	Adjuvant induced arthritis QTL 11	4.06		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	26522051	71522051	Rat
9590154	Scort9	Serum corticosterone level QTL 9	23.57	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	12860942	57860942	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	22019705	67019705	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24390595	84432719	Rat
9590088	Insglur7	Insulin/glucose ratio QTL 7	20.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	17	12860942	57860942	Rat
2317053	Aia25	Adjuvant induced arthritis QTL 25	2.69		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	10604694	55604694	Rat
1354613	Kidm14	Kidney mass QTL 14	6.2		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	17	1	36045694	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15537025	60531414	Rat
7411666	Foco31	Food consumption QTL 31	11.4	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	17	12860942	57860942	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4733534	49733534	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23858926	68858926	Rat
70184	BpQTLcluster14	Blood pressure QTL cluster 14	3.38		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	8574342	32199534	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23858926	68858926	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27233445	65155015	Rat
4889891	Eae32	Experimental allergic encephalomyelitis QTL 32	4.8	0.0002	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	17	27233445	72233445	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23858926	68858926	Rat
631207	Niddm41	Non-insulin dependent diabetes mellitus QTL 41			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	17	1	38037084	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23858926	68858926	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23858926	68858926	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	43999106	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23858926	68858926	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	43999106	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			24136127	84432719	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	24136127	84432719	Rat

Markers in Region

Rnasep1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	17	28,955,119 - 28,956,732 (+)	MAPPER	mRatBN7.2
Rnor_6.0	17	29,646,039 - 29,647,651	NCBI	Rnor6.0
Rnor_5.0	17	31,541,923 - 31,543,535	UniSTS	Rnor5.0
RGSC_v3.4	17	35,256,223 - 35,257,835	UniSTS	RGSC3.4
Cytogenetic Map	17	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001399354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC117279	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC091191	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473977	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220078	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000021877 ⟹ ENSRNOP00000021877

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	29,153,555 - 29,162,241 (+)	Ensembl
mRatBN7.2 Ensembl	17	28,948,160 - 28,956,787 (+)	Ensembl
Rnor_6.0 Ensembl	17	29,639,079 - 29,647,706 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000068617 ⟹ ENSRNOP00000062962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	29,153,180 - 29,162,239 (+)	Ensembl
mRatBN7.2 Ensembl	17	28,947,755 - 28,956,781 (+)	Ensembl
Rnor_6.0 Ensembl	17	29,638,677 - 29,647,763 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103750 ⟹ ENSRNOP00000078066

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	29,153,180 - 29,162,239 (+)	Ensembl
mRatBN7.2 Ensembl	17	28,947,734 - 28,956,788 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000130450 ⟹ ENSRNOP00000108962

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	17	29,153,180 - 29,162,239 (+)	Ensembl

RefSeq Acc Id:

NM_001013055 ⟹ NP_001013073

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	29,153,555 - 29,162,241 (+)	NCBI
mRatBN7.2	17	28,948,104 - 28,956,788 (+)	NCBI
Rnor_6.0	17	29,639,079 - 29,647,707 (+)	NCBI
Rnor_5.0	17	31,534,547 - 31,543,593 (+)	NCBI
RGSC_v3.4	17	35,249,263 - 35,257,891 (+)	RGD
Celera	17	28,549,277 - 28,557,686 (+)	RGD

Sequence:

show sequence

CAAGATTGAGATCCTGGGTAACTCAATGCGGGGGTCGGGCAGGCACGGAGGAGTTAGGAATGCA
ACCTGCACAACACGTAGCCGACTTGCTCCCTAAGTCTGTGCAGTTCTCTGTGAATCAGCTTGTG
ACTCTTTCCAAAGCATCACGCGGTTTGACAACCGAGGAACTCCAAAAACACTTACCTTAAGGTT
TCATTTCTTATTCCTGAGTGTGGGCTGCTATCAAAAAAACTAAAAGACCTGGTCATGGAAATGG
GACCCTATTACTCTGTGAAGAAGTTACCTCTTCATGAATTAATTACACATGAATTCATCAACAC
CTTTGTAAAGAAAGGTTCACTCTCTGCATTAACGTACAATACAAGTATTGATGAGGATAATACT
GTTGCTCTCCTACCAAATGGGAAATTAATTTTATCACTGGATAAAGATACTTATGAAGAGACTG
GACTCCAAGGCCATCCATCTCGGTATTCTGGCAGAAAAAGTATGAGGTTTATCATTTCCATTGA
TCTAATGGATTTATCCCTTAACCTGGATTCTAAGAAATACAGAAGAATATCTTGGTCCTTCAAA
GAAAAGAAGCCTTTGAAGTTTGATTTCCTTTTGGCTTGGCATCATACAGGTACAGAAGAATCAA
CAATGATGTCATACTTTTCCAAATACCAAATTCGGGAGCATCAGCCAAAAGTGGCCTTGAGCAC
AGTAAGAGATCTGCAGTGCCCAGTGCTTCAGAGCAGCAGCCTTGCAGGGGAGCCGGAGGAGGCC
TGCAATGCCCTGGAGTTCTTCGACTGGCTTGGTGCCGTCTTCTGCAACGCGGACCTAAATAATG
AACCTCATAATTTCATATCAACCTACTGCTGTCCACAGCCAAACACAGTGGCAGCCCAAGCTTG
TCTGTGTACAATCACAGGTTTCGTGTTGCCAGAGAAGATACTTGTCCTTCTGGAACAGCTGTGT
CACTACTTTGATGAACCGAAGTTGGCTCCATGGGTCACCTTGACAGTTCAAGGCTTTGCAGACA
GCCCCGTTGCATGGAGGGAGAAGGAACACGGCTTCCACAAAGGAGGAGAGCACTTGTACAATTT
TGTTGTTTTCAATAATCAGGACTATTGGCTTCAGATGGCTGTTGGAGCAAATGATGACTGCCCA
CCATAAAAAATGCAAAGTTTAGAGCCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NM_001399354 ⟹ NP_001386283

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	29,153,203 - 29,162,241 (+)	NCBI
mRatBN7.2	17	28,947,752 - 28,956,788 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001013073	(Get FASTA)	NCBI Sequence Viewer
	NP_001386283	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH91191	(Get FASTA)	NCBI Sequence Viewer
	EDL98288	(Get FASTA)	NCBI Sequence Viewer
	EDL98289	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000021877
	ENSRNOP00000021877.4
	ENSRNOP00000062962
GenBank Protein	Q5BK64	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001013073 ⟸ NM_001013055
- Peptide Label:	isoform 1
- UniProtKB:	A0A8L2QUY7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEMGPYYSVKKLPLHELITHEFINTFVKKGSLSALTYNTSIDEDNTVALLPNGKLILSLDKDTY EETGLQGHPSRYSGRKSMRFIISIDLMDLSLNLDSKKYRRISWSFKEKKPLKFDFLLAWHHTGT EESTMMSYFSKYQIREHQPKVALSTVRDLQCPVLQSSSLAGEPEEACNALEFFDWLGAVFCNAD LNNEPHNFISTYCCPQPNTVAAQACLCTITGFVLPEKILVLLEQLCHYFDEPKLAPWVTLTVQG FADSPVAWREKEHGFHKGGEHLYNFVVFNNQDYWLQMAVGANDDCPP hide sequence

Ensembl Acc Id:

ENSRNOP00000021877 ⟸ ENSRNOT00000021877

Ensembl Acc Id:

ENSRNOP00000062962 ⟸ ENSRNOT00000068617

Ensembl Acc Id:

ENSRNOP00000078066 ⟸ ENSRNOT00000103750

RefSeq Acc Id:	NP_001386283 ⟸ NM_001399354
- Peptide Label:	isoform 2
- UniProtKB:	Q5BK64 (UniProtKB/Swiss-Prot), A0A8L2QUY7 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000108962 ⟸ ENSRNOT00000130450

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5BK64-F1-model_v2	AlphaFold	Q5BK64	1-363	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700412

Promoter ID:

EPDNEW_R10926

Type:

multiple initiation site

Name:

Rpp40_1

Description:

ribonuclease P/MRP subunit p40

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	29,638,685 - 29,638,745	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1310228	AgrOrtholog
BioCyc Gene	G2FUF-9629	BioCyc
Ensembl Genes	ENSRNOG00000016226	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000021877	ENTREZGENE
	ENSRNOT00000021877.6	UniProtKB/Swiss-Prot
	ENSRNOT00000068617	ENTREZGENE
IMAGE_CLONE	IMAGE:7368273	IMAGE-MGC_LOAD
InterPro	RNase_P_Rpp40	UniProtKB/Swiss-Prot
KEGG Report	rno:291071	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108849	IMAGE-MGC_LOAD
NCBI Gene	291071	ENTREZGENE
PANTHER	PTHR15396	UniProtKB/Swiss-Prot
	RIBONUCLEASE P PROTEIN SUBUNIT P40	UniProtKB/Swiss-Prot
Pfam	Ribonuc_P_40	UniProtKB/Swiss-Prot
PhenoGen	Rpp40	PhenoGen
RatGTEx	ENSRNOG00000016226	RatGTEx
UniProt	A0A8I5Y2C9_RAT	UniProtKB/TrEMBL
	A0A8L2QUY7	ENTREZGENE, UniProtKB/TrEMBL
	A0ABK0LE62_RAT	UniProtKB/TrEMBL
	A6J7D8_RAT	UniProtKB/TrEMBL
	A6J7D9_RAT	UniProtKB/TrEMBL
	Q5BK64	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-03-27	Rpp40	ribonuclease P/MRP subunit p40	Rpp40	ribonuclease P/MRP 40 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-02-04	Rpp40	ribonuclease P/MRP 40 subunit	Rpp40	ribonuclease P 40 subunit (human)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-06	Rpp40	ribonuclease P 40 subunit (human)	Rpp40_predicted	ribonuclease P 40 subunit (human) (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Rpp40_predicted	ribonuclease P (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - KEGG (archival)