Advanced Search (OLGA)

Gene: Cbr3 (carbonyl reductase 3) Rattus norvegicus

Analyze

Symbol:

Cbr3

Name:

carbonyl reductase 3

RGD ID:

1309728

Description:

Enables 3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity and carbonyl reductase (NADPH) activity. Involved in phylloquinone catabolic process. Predicted to be located in cytosol. Orthologous to human CBR3 (carbonyl reductase 3); PARTICIPATES IN doxorubicin pharmacokinetics pathway; arachidonic acid metabolic pathway; INTERACTS WITH 17beta-estradiol; 3,3',4,4',5-pentachlorobiphenyl; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

carbonyl reductase [NADPH] 3; LOC304078; monomeric carbonyl reductase 3; quinone reductase CBR3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CBR3 (carbonyl reductase 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Cbr3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cbr3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CBR3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CBR3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Cbr3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CBR3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CBR3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cbr3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Cbr3 (carbonyl reductase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CBR1 (carbonyl reductase 1)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	CBR3 (carbonyl reductase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Cbr3 (carbonyl reductase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cbr1 (carbonyl reductase 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cbr1 (carbonyl reductase 1)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cbr1l (carbonyl reductase 1-like)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	cbr1l (carbonyl reductase 1-like)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	sni	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C55A6.7	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Caenorhabditis elegans (roundworm):	dhs-31	Alliance	DIOPT (Ensembl Compara\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	cbr1.2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	46,478,295 - 46,486,555 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	46,478,274 - 46,486,558 (+)	Ensembl				GRCr8
mRatBN7.2	11	33,008,615 - 33,016,877 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	33,008,615 - 33,016,875 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	41,662,664 - 41,670,924 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	34,334,206 - 34,342,467 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	33,484,246 - 33,492,418 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	33,909,417 - 33,917,674 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	33,909,439 - 33,917,674 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	37,500,661 - 37,508,918 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	33,913,961 - 33,922,221 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	35,427,193 - 35,435,432 (-)	NCBI		Celera
RGSC_v3.1	11	33,961,819 - 33,978,463 (+)	NCBI
Cytogenetic Map	11	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autism spectrum disorder (ISO)

Familial Platelet Disorder with Associated Myeloid Malignancy (ISO)

Mouth Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

1H-pyrazole (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-palmitoylglycerol (ISO)

2-tert-butylhydroquinone (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-chloropropane-1,2-diol (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

9,10-phenanthroquinone (ISO)

acrylamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

alvocidib (ISO)

andrographolide (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

Benzo[k]fluoranthene (ISO)

beta-D-glucosamine (ISO)

beta-naphthoflavone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

bortezomib (ISO)

buta-1,3-diene (ISO)

cadmium dichloride (EXP,ISO)

cadmium sulfate (ISO)

captan (ISO)

celastrol (ISO)

chlordecone (ISO)

chloroprene (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

cobicistat (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

D-glucose (ISO)

daunorubicin (ISO)

dextran sulfate (ISO)

dibenzoylmethane (ISO)

Dibutyl phosphate (ISO)

diethyl maleate (ISO)

diquat (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

Ethyl malonate (ISO)

fenamidone (ISO)

folic acid (ISO)

folpet (ISO)

furan (ISO)

gedunin (ISO)

gentamycin (EXP)

glucose (ISO)

glutathione (ISO)

glycidol (ISO)

guggulsterone (ISO)

hydrogen peroxide (ISO)

inulin (ISO)

isatin (ISO)

ivermectin (ISO)

ketamine (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

lithium atom (ISO)

lithium hydride (ISO)

menadione (ISO)

metacetamol (ISO)

methapyrilene (ISO)

methoxyacetic acid (ISO)

methyl methacrylate (ISO)

methyl methanesulfonate (ISO)

methylparaben (ISO)

methylphenidate (ISO)

microcystin-LR (ISO)

Monobutylphthalate (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-Nitrosopyrrolidine (ISO)

NADP zwitterion (ISO)

NADP(+) (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

oxcarbazepine (ISO)

ozone (ISO)

paracetamol (EXP,ISO)

pentachlorophenol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

permethrin (ISO)

phenobarbital (ISO)

phosgene (ISO)

pirinixic acid (ISO)

progesterone (ISO)

propiconazole (ISO)

resveratrol (ISO)

rifampicin (ISO)

rotenone (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

Soman (EXP)

sulforaphane (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

toluene (EXP)

trichloroethene (EXP)

Triptolide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cognition (IEA,ISO)

phylloquinone catabolic process (IDA,IEA)

Cellular Component

cytoplasm (IEA)

cytosol (IEA,ISO,ISS)

Molecular Function

3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity (IDA)

carbonyl reductase (NADPH) activity (IBA,IDA,IEA,ISO)

NADPH binding (IEA,ISO)

NADPH dehydrogenase (quinone) activity (IEA,ISO,ISS)

oxidoreductase activity (IEA)

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

arachidonic acid metabolic pathway (IEA)

doxorubicin pharmacokinetics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Hippocampal protein expression is differentially affected by chronic paroxetine treatment in adolescent and adult rats: a possible mechanism of "paradoxical" antidepressant responses in young persons.	Karanges EA, etal., Front Pharmacol. 2013 Jul 8;4:86. doi: 10.3389/fphar.2013.00086. eCollection 2013.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Investigation of the role of the amino acid residue at position 230 for catalysis in monomeric carbonyl reductase 3.	Miura T, etal., Chem Biol Interact. 2009 Mar 16;178(1-3):211-4. Epub 2008 Oct 15.
6.	New developments in anthracycline-induced cardiotoxicity.	Mordente A, etal., Curr Med Chem. 2009;16(13):1656-72.
7.	Carbonyl Reductase 3 (CBR3) Mediates 9-cis-Retinoic Acid-Induced Cytostatis and is a Potential Prognostic Marker for Oral Malignancy.	Ohkura-Hada S, etal., Open Dent J. 2008;2:78-88. Epub 2008 Jun 9.
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	Doxorubicin pathways: pharmacodynamics and adverse effects.	Thorn CF, etal., Pharmacogenet Genomics. 2011 Jul;21(7):440-6. doi: 10.1097/FPC.0b013e32833ffb56.

Additional References at PubMed

PMID:12477932	PMID:18493841	PMID:22664934	PMID:23227193

Genomics

Comparative Map Data

Cbr3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	46,478,295 - 46,486,555 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	11	46,478,274 - 46,486,558 (+)	Ensembl				GRCr8
mRatBN7.2	11	33,008,615 - 33,016,877 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	33,008,615 - 33,016,875 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	11	41,662,664 - 41,670,924 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	34,334,206 - 34,342,467 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	33,484,246 - 33,492,418 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	33,909,417 - 33,917,674 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	33,909,439 - 33,917,674 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	11	37,500,661 - 37,508,918 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	11	33,913,961 - 33,922,221 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	11	35,427,193 - 35,435,432 (-)	NCBI		Celera
RGSC_v3.1	11	33,961,819 - 33,978,463 (+)	NCBI
Cytogenetic Map	11	q11	NCBI

CBR3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	21	36,135,079 - 36,146,562 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	21	36,135,079 - 36,146,566 (+)	Ensembl			hg38	GRCh38
GRCh37	21	37,507,377 - 37,518,860 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	21	36,429,133 - 36,440,730 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	21	36,364,264 - 36,440,724	NCBI
Celera	21	22,706,132 - 22,717,559 (+)	NCBI		Celera
Cytogenetic Map	21	q22.12	NCBI
HuRef	21	22,984,935 - 22,996,359 (+)	NCBI		HuRef
CHM1_1	21	37,069,046 - 37,080,642 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	21	34,518,104 - 34,529,412 (+)	NCBI		T2T-CHM13v2.0

Cbr3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	93,480,107 - 93,487,879 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	93,480,103 - 93,487,878 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	16	93,683,219 - 93,690,991 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	93,683,215 - 93,690,990 (+)	Ensembl			mm10	GRCm38
MGSCv37	16	93,683,464 - 93,691,236 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	16	93,571,759 - 93,579,527 (+)	NCBI		MGSCv36	mm8
Celera	16	94,777,963 - 94,785,655 (+)	NCBI		Celera
Cytogenetic Map	16	C4	NCBI
cM Map	16	54.58	NCBI

Cbr3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955407	35,419,674 - 35,428,270 (+)	Ensembl
ChiLan1.0	NW_004955407	35,419,674 - 35,428,270 (+)	NCBI	ChiLan1.0	ChiLan1.0

CBR3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	22	32,256,031 - 32,267,414 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	21	27,115,995 - 27,128,098 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	21	22,505,647 - 22,516,938 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	21	35,865,374 - 35,876,717 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	21	35,865,374 - 35,876,717 (+)	Ensembl			panPan2	panpan1.1

CBR3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	31	31,416,441 - 31,423,797 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	31	31,416,333 - 31,423,739 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	31	30,472,787 - 30,480,043 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	31	30,713,351 - 30,720,605 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	31	30,713,139 - 30,720,547 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	31	30,585,631 - 30,592,893 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	31	30,599,689 - 30,606,933 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	31	31,090,527 - 31,097,817 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Cbr3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404971	30,998,820 - 31,006,047 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936500	6,458,721 - 6,591,928 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936500	6,461,776 - 6,469,063 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CBR3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	199,830,668 - 199,840,442 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	199,830,690 - 199,840,444 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	209,842,863 - 209,852,618 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CBR3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	80,158,842 - 80,164,208 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	80,158,806 - 80,164,248 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666054	7,988,123 - 7,999,978 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cbr3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624745	27,294,222 - 27,305,109 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624745	27,298,714 - 27,305,606 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Cbr3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	4	50,945,959 - 50,954,683 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Cbr3
40 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	29
Count of miRNA genes:	24
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000002310
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	22524746	82951192	Rat
1598841	Memor7	Memory QTL 7			exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	11	33306008	78306008	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	46443168	91443168	Rat
1598842	Glom10	Glomerulus QTL 10	3.4		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	3818154	48818154	Rat
1598811	Bp291	Blood pressure QTL 291	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	33306008	78306008	Rat
634339	Niddm50	Non-insulin dependent diabetes mellitus QTL 50	3.32		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	10806125	55806125	Rat
634341	Bw121	Body weight QTL 121	3.56		abdominal fat pad mass (VT:1000711)	abdominal fat pad weight (CMO:0000088)	11	35323199	55805892	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
10755497	Bp388	Blood pressure QTL 388	2.76		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	32943067	89836615	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	29958996	57754989	Rat
2290451	Scl58	Serum cholesterol level QTL 58	3.48		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	11	26318031	55806125	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	31915469	76915469	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	36428416	81428416	Rat
1600394	Edcs1	Endometrial carcinoma susceptibility QTL1	2.9	0.04	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	11	12823152	57823152	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	34618760	79618760	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	20193549	96351019	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	36749459	81749459	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	36749459	81749459	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	36749459	81749459	Rat
631510	Spl2	Serum phospholipid level QTL 2	4.1		blood phospholipid amount (VT:0006084)	serum phospholipid level (CMO:0001171)	11	27556685	72556685	Rat

Markers in Region

RH127062

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	33,016,611 - 33,016,857 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	33,917,411 - 33,917,656	NCBI	Rnor6.0
Rnor_5.0	11	37,508,655 - 37,508,900	UniSTS	Rnor5.0
RGSC_v3.4	11	33,921,958 - 33,922,203	UniSTS	RGSC3.4
Celera	11	35,427,211 - 35,427,456	UniSTS
Cytogenetic Map	11	q11	UniSTS

RH137117

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	33,016,634 - 33,016,817 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	33,917,434 - 33,917,616	NCBI	Rnor6.0
Rnor_5.0	11	37,508,678 - 37,508,860	UniSTS	Rnor5.0
RGSC_v3.4	11	33,921,981 - 33,922,163	UniSTS	RGSC3.4
Celera	11	35,427,251 - 35,427,433	UniSTS
RH 3.4 Map	16	97.8	UniSTS
Cytogenetic Map	11	q11	UniSTS

RH137712

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	11	33,014,448 - 33,014,596 (+)	MAPPER	mRatBN7.2
Rnor_6.0	11	33,915,248 - 33,915,395	NCBI	Rnor6.0
Rnor_5.0	11	37,506,492 - 37,506,639	UniSTS	Rnor5.0
RGSC_v3.4	11	33,919,795 - 33,919,942	UniSTS	RGSC3.4
Celera	11	35,429,472 - 35,429,619	UniSTS
Cytogenetic Map	11	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	86	59	6	350	186	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107110	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC166553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234106	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000002310 ⟹ ENSRNOP00000002310

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	11	46,478,274 - 46,486,558 (+)	Ensembl
mRatBN7.2 Ensembl	11	33,008,615 - 33,016,875 (+)	Ensembl
Rnor_6.0 Ensembl	11	33,909,439 - 33,917,674 (+)	Ensembl

RefSeq Acc Id:

NM_001107110 ⟹ NP_001100580

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	46,478,295 - 46,486,555 (+)	NCBI
mRatBN7.2	11	33,008,615 - 33,016,875 (+)	NCBI
Rnor_6.0	11	33,909,417 - 33,917,674 (+)	NCBI
Rnor_5.0	11	37,500,661 - 37,508,918 (+)	NCBI
RGSC_v3.4	11	33,913,961 - 33,922,221 (+)	RGD
Celera	11	35,427,193 - 35,435,432 (-)	RGD

Sequence:

show sequence

AGCAGTCGCAGCGCCCAGTTCCAGAATCAAGTCCTACGCCAGGGTTCTGACCACGGCGTGACCC
GCTGCCCAGCCGGTCTGACAGTCCGGTGGTCCGTGTGTCCCTCTGACATGTCGTCCTGCAGCCG
CGTGGCCCTGGTGACTGGGGCTAACAAAGGCATCGGCTTCGCGATCACGCGTGACCTGTGTCGG
AAATTCTCGGGGGACGTGGTGCTCACGGCGCGGGACGAGGCGCGGGGCCGCGCAGCGGTGAAGC
AGCTGCAGGCGGAGGGCCTGAGCCCACGCTTCCACCAGCTGGACATCGACAACCCGCAGAGCAT
CCGCGCGCTGCGCGACTTTCTGCGCAAGGAGTACGGAGGACTTAACGTGCTGGTCAACAATGCG
GGCATCGCCTTTAGAATGGATGATCCAACGCCCTTCGACGTTCAAGCTGAGGTGACACTGAAGA
CGAACTTCTTTGCCACTAGAAATGTCTGCACCGAGCTGCTGCCCATAATGAAACCACATGGTAG
AGTGGTGAATGTCAGCAGTCTGCAGGGGTTAAAAGCCCTTGAAAACTGCAGCGAAGATCTTCAG
GAAAGGTTCCGATGTGACACACTTACCGAGGGGGATCTGGTCGACCTCATGAAAAAGTTTGTGG
AGGACACAAAAAATGAAGTCCACGAGAGAGAAGGTTGGCCAGACTCAGCTTACGGGGTGTCCAA
GCTGGGCGTGACAGTCCTTACGAGAATCCTGGCCCGGCAGCTGGACGAGAAGAGGAAAGCGGAC
AGGATTTTGCTGAATGCCTGCTGCCCGGGATGGGTGAAGACCGACATGGCGAGGGACCAGGGCT
CCAGGACCGTGGAAGAGGGGGCAGAAACCCCCGTTTACTTGGCCCTCCTGCCTCCAGATGCCAC
TGAGCCTCATGGCCAGCTCGTCCGTGACAAAGTTGTGCAAACGTGGTGAACGTCTGCTCTGGGG
CTTAACAGTTTGATAAACGTTAGCGTGAGAGATGAATGCAGGCTGGTGCGGTTTGGTTTTTTTC
CCCACGAGGAGGAGGAAGGTCCGTTTCTCTCTGTGGCTCTACAAGCTCAATCTGAACAATTTGC
TTTGTCCAAACTCTCTTAGCTCGCGGTGTTTTCATCCAGTTAATGTGCCTGCTTTGTTTTTCAA
ATTAAAAAGATTTATTTGTTTTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100580	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI66553	(Get FASTA)	NCBI Sequence Viewer
	B2GV72	(Get FASTA)	NCBI Sequence Viewer
	EDL76737	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002310
	ENSRNOP00000002310.4

RefSeq Acc Id:

NP_001100580 ⟸ NM_001107110

- UniProtKB:

B2GV72 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSSCSRVALVTGANKGIGFAITRDLCRKFSGDVVLTARDEARGRAAVKQLQAEGLSPRFHQLDI
DNPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDVQAEVTLKTNFFATRNVCTELLPI
MKPHGRVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHEREGWPDS
AYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQGSRTVEEGAETPVYLAL
LPPDATEPHGQLVRDKVVQTW

hide sequence

Ensembl Acc Id:

ENSRNOP00000002310 ⟸ ENSRNOT00000002310

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B2GV72-F1-model_v2	AlphaFold	B2GV72	1-277	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698073

Promoter ID:

EPDNEW_R8598

Type:

initiation region

Name:

Cbr3_1

Description:

carbonyl reductase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	33,909,439 - 33,909,499	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1309728	AgrOrtholog
BioCyc Gene	G2FUF-21788	BioCyc
Ensembl Genes	ENSRNOG00000001701	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000002310	ENTREZGENE
	ENSRNOT00000002310.7	UniProtKB/Swiss-Prot
Gene3D-CATH	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7310545	IMAGE-MGC_LOAD
InterPro	CBR1-like	UniProtKB/Swiss-Prot
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot
	Sc_DH/Rdtase_CS	UniProtKB/Swiss-Prot
	SDR_fam	UniProtKB/Swiss-Prot
KEGG Report	rno:304078	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:188162	IMAGE-MGC_LOAD
NCBI Gene	304078	ENTREZGENE
PANTHER	CARBONYL REDUCTASE 1-RELATED	UniProtKB/Swiss-Prot
	CARBONYL REDUCTASE [NADPH] 3	UniProtKB/Swiss-Prot
Pfam	adh_short	UniProtKB/Swiss-Prot
PharmGKB	CBR3	RGD
PhenoGen	Cbr3	PhenoGen
PRINTS	GDHRDH	UniProtKB/Swiss-Prot
	SDRFAMILY	UniProtKB/Swiss-Prot
PROSITE	ADH_SHORT	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000001701	RatGTEx
Superfamily-SCOP	SSF51735	UniProtKB/Swiss-Prot
UniProt	B2GV72	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Cbr3	carbonyl reductase 3	Cbr3_predicted	carbonyl reductase 3 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Cbr3_predicted	carbonyl reductase 3 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)