Advanced Search (OLGA)

Gene: Mtfmt (mitochondrial methionyl-tRNA formyltransferase) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Mtfmt

Name:

mitochondrial methionyl-tRNA formyltransferase

RGD ID:

1309462

Description:

Predicted to enable methionyl-tRNA formyltransferase activity. Predicted to be involved in conversion of methionyl-tRNA to N-formyl-methionyl-tRNA. Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in combined oxidative phosphorylation deficiency 15 and nuclear type mitochondrial complex I deficiency 27. Orthologous to human MTFMT (mitochondrial methionyl-tRNA formyltransferase); PARTICIPATES IN folate metabolic pathway; glycine N-methyltransferase deficiency pathway; hereditary folate malabsorption pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC315763; methionyl-tRNA formyltransferase, mitochondrial; MGC95129; RGD1309462; similar to RIKEN cDNA 2310020P08

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	74,848,936 - 74,866,987 (+)	NCBI		GRCr8
mRatBN7.2	8	65,953,787 - 65,971,841 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	65,953,767 - 65,971,841 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	71,466,158 - 71,484,219 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	69,739,169 - 69,757,231 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	67,608,805 - 67,626,822 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	70,952,209 - 70,986,393 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	70,952,203 - 70,986,408 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	70,644,131 - 70,674,636 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	69,683,737 - 69,701,721 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	69,702,790 - 69,720,775 (+)	NCBI
Celera	8	65,351,577 - 65,369,621 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfmt	Rat	Bloom syndrome		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Mtfmt	Rat	colorectal cancer		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Mtfmt	Rat	combined oxidative phosphorylation deficiency 15		ISO	MTFMT (Homo sapiens)	8554872	ClinVar more ...	ClinVar	PMID:21907147 more ...
Mtfmt	Rat	Dwarfism		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Short stature	ClinVar	PMID:21907147 more ...
Mtfmt	Rat	genetic disease		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:21907147 more ...
Mtfmt	Rat	Leigh disease		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leigh syndrome	ClinVar	PMID:21907147 more ...
Mtfmt	Rat	microcephaly		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Microcephaly	ClinVar	PMID:25741868 and PMID:28492532
Mtfmt	Rat	mitochondrial complex I deficiency		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Mitochondrial oxidative phosphorylation disorder	ClinVar	PMID:24033266 more ...
Mtfmt	Rat	nemaline myopathy 6		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Nemaline myopathy 6	ClinVar	PMID:21681106 more ...
Mtfmt	Rat	nuclear type mitochondrial complex I deficiency 27		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: MITOCHONDRIAL COMPLEX I DEFICIENCY and NUCLEAR TYPE 27	ClinVar	PMID:21907147 more ...
Mtfmt	Rat	Subacute Necrotizing Encephalopathy of Leigh, Infantile		ISO	MTFMT (Homo sapiens)	8554872	ClinVar Annotator: match by term: Leigh's necrotizing encephalopathy	ClinVar	PMID:21907147 more ...

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfmt	Rat	combined oxidative phosphorylation deficiency 15		ISO	MTFMT (Homo sapiens)	7240710		OMIM
Mtfmt	Rat	nuclear type mitochondrial complex I deficiency 27		ISO	MTFMT (Homo sapiens)	7240710		OMIM

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfmt	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	MTFMT (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MTFMT mRNA	CTD	PMID:22079256
Mtfmt	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	Mtfmt (Mus musculus)	6480464	Tetrachlorodibenzodioxin results in decreased expression of MTFMT mRNA	CTD	PMID:16611356
Mtfmt	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of MTFMT mRNA	CTD	PMID:33387578
Mtfmt	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	Mtfmt (Mus musculus)	6480464	Tetrachlorodibenzodioxin affects the expression of MTFMT mRNA	CTD	PMID:21570461
Mtfmt	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of MTFMT mRNA	CTD	PMID:21215274
Mtfmt	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2 and 4-dinitrotoluene affects the expression of MTFMT mRNA	CTD	PMID:21346803
Mtfmt	Rat	2,6-dinitrotoluene	affects expression	EXP		6480464	2 and 6-dinitrotoluene affects the expression of MTFMT mRNA	CTD	PMID:21346803
Mtfmt	Rat	2-hydroxypropanoic acid	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Lactic Acid results in decreased expression of MTFMT mRNA	CTD	PMID:30851411
Mtfmt	Rat	atrazine	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Atrazine results in decreased expression of MTFMT mRNA	CTD	PMID:22378314
Mtfmt	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of MTFMT mRNA	CTD	PMID:25181051 and PMID:34947998
Mtfmt	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of MTFMT mRNA	CTD	PMID:30816183 and PMID:32528016
Mtfmt	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of MTFMT mRNA	CTD	PMID:33453195
Mtfmt	Rat	cadmium dichloride	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Cadmium Chloride results in decreased expression of MTFMT mRNA	CTD	PMID:38568856
Mtfmt	Rat	ciguatoxin CTX1B	affects expression	ISO	Mtfmt (Mus musculus)	6480464	Ciguatoxins affects the expression of MTFMT mRNA	CTD	PMID:18353800
Mtfmt	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of MTFMT mRNA	CTD	PMID:24386269
Mtfmt	Rat	copper atom	multiple interactions	ISO	MTFMT (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of MTFMT mRNA	CTD	PMID:20971185
Mtfmt	Rat	copper(0)	multiple interactions	ISO	MTFMT (Homo sapiens)	6480464	[NSC 689534 binds to Copper] which results in decreased expression of MTFMT mRNA	CTD	PMID:20971185
Mtfmt	Rat	copper(II) sulfate	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Copper Sulfate results in decreased expression of MTFMT mRNA	CTD	PMID:19549813
Mtfmt	Rat	cyclosporin A	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Cyclosporine results in decreased expression of MTFMT mRNA	CTD	PMID:25562108
Mtfmt	Rat	dibutyl phthalate	decreases expression	ISO	Mtfmt (Mus musculus)	6480464	Dibutyl Phthalate results in decreased expression of MTFMT mRNA	CTD	PMID:17361019 and PMID:21266533
Mtfmt	Rat	epoxiconazole	increases expression	ISO	Mtfmt (Mus musculus)	6480464	epoxiconazole results in increased expression of MTFMT mRNA	CTD	PMID:35436446
Mtfmt	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of MTFMT mRNA	CTD	PMID:24136188
Mtfmt	Rat	GW 4064	decreases expression	ISO	Mtfmt (Mus musculus)	6480464	GW 4064 results in decreased expression of MTFMT mRNA	CTD	PMID:29416063
Mtfmt	Rat	GW 4064	multiple interactions	ISO	Mtfmt (Mus musculus)	6480464	NR0B2 protein promotes the reaction [GW 4064 results in decreased expression of MTFMT mRNA]	CTD	PMID:29416063
Mtfmt	Rat	josamycin	decreases response to substance	ISO	MTFMT (Homo sapiens)	6480464	MTFMT protein results in decreased susceptibility to Josamycin	CTD	PMID:31915244
Mtfmt	Rat	paracetamol	affects expression	ISO	Mtfmt (Mus musculus)	6480464	Acetaminophen affects the expression of MTFMT mRNA	CTD	PMID:17562736
Mtfmt	Rat	paracetamol	increases expression	ISO	MTFMT (Homo sapiens)	6480464	Acetaminophen results in increased expression of MTFMT mRNA	CTD	PMID:25704631 and PMID:31059760
Mtfmt	Rat	potassium chromate	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	potassium chromate(VI) results in decreased expression of MTFMT mRNA	CTD	PMID:22079256
Mtfmt	Rat	potassium chromate	multiple interactions	ISO	MTFMT (Homo sapiens)	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of MTFMT mRNA	CTD	PMID:22079256
Mtfmt	Rat	rac-lactic acid	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Lactic Acid results in decreased expression of MTFMT mRNA	CTD	PMID:30851411
Mtfmt	Rat	sodium arsenate	decreases expression	ISO	Mtfmt (Mus musculus)	6480464	sodium arsenate results in decreased expression of MTFMT mRNA	CTD	PMID:30953684
Mtfmt	Rat	sodium arsenite	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	sodium arsenite results in decreased expression of MTFMT mRNA	CTD	PMID:38568856
Mtfmt	Rat	Soman	decreases expression	EXP		6480464	Soman results in decreased expression of MTFMT mRNA	CTD	PMID:19281266
Mtfmt	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of MTFMT mRNA	CTD	PMID:31150632
Mtfmt	Rat	thapsigargin	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Thapsigargin results in decreased expression of MTFMT mRNA	CTD	PMID:22378314
Mtfmt	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of MTFMT mRNA	CTD	PMID:34492290
Mtfmt	Rat	thiram	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Thiram results in decreased expression of MTFMT mRNA	CTD	PMID:38568856
Mtfmt	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of MTFMT mRNA	CTD	PMID:33387578
Mtfmt	Rat	triphenyl phosphate	affects expression	ISO	MTFMT (Homo sapiens)	6480464	triphenyl phosphate affects the expression of MTFMT mRNA	CTD	PMID:37042841
Mtfmt	Rat	triptonide	decreases expression	ISO	Mtfmt (Mus musculus)	6480464	triptonide results in decreased expression of MTFMT mRNA	CTD	PMID:33045310
Mtfmt	Rat	tungsten	increases expression	ISO	Mtfmt (Mus musculus)	6480464	Tungsten results in increased expression of MTFMT mRNA	CTD	PMID:30912803
Mtfmt	Rat	tunicamycin	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Tunicamycin results in decreased expression of MTFMT mRNA	CTD	PMID:22378314
Mtfmt	Rat	urethane	decreases expression	ISO	MTFMT (Homo sapiens)	6480464	Urethane results in decreased expression of MTFMT mRNA	CTD	PMID:28818685
Mtfmt	Rat	valproic acid	affects expression	ISO	Mtfmt (Mus musculus)	6480464	Valproic Acid affects the expression of MTFMT mRNA	CTD	PMID:17292431

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfmt	Rat	biosynthetic process	involved_in	IEA	InterPro:IPR002376 more ...	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Mtfmt	Rat	conversion of methionyl-tRNA to N-formyl-methionyl-tRNA	involved_in	IEA	UniProtKB:Q96DP5 and ensembl:ENSP00000220058	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfmt	Rat	conversion of methionyl-tRNA to N-formyl-methionyl-tRNA	involved_in	IEA	InterPro:IPR005794	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Mtfmt	Rat	conversion of methionyl-tRNA to N-formyl-methionyl-tRNA	involved_in	IBA	PANTHER:PTN000124109 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mtfmt	Rat	conversion of methionyl-tRNA to N-formyl-methionyl-tRNA	involved_in	ISS	UniProtKB:O77480	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mtfmt	Rat	conversion of methionyl-tRNA to N-formyl-methionyl-tRNA	involved_in	ISO	MTFMT (Homo sapiens)	1624291	PMID:25288793	RGD	PMID:25288793
Mtfmt	Rat	translation	involved_in	IEA	UniProtKB-KW:KW-0648	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mtfmt	Rat	translational initiation	involved_in	IEA	GO:0004479	1600115	GO_REF:0000108	GOC	GO_REF:0000108

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfmt	Rat	mitochondrion	located_in	ISS	UniProtKB:O77480	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mtfmt	Rat	mitochondrion	located_in	IEA	UniProtKB-SubCell:SL-0173	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Mtfmt	Rat	mitochondrion	located_in	IEA	UniProtKB-KW:KW-0496	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Mtfmt	Rat	mitochondrion	is_active_in	IBA	PANTHER:PTN000875736 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfmt	Rat	methionyl-tRNA formyltransferase activity	enables	IEA	UniProtKB:Q96DP5 and ensembl:ENSP00000220058	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Mtfmt	Rat	methionyl-tRNA formyltransferase activity	enables	IEA	EC:2.1.2.9	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Mtfmt	Rat	methionyl-tRNA formyltransferase activity	enables	IBA	PANTHER:PTN000124109 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Mtfmt	Rat	methionyl-tRNA formyltransferase activity	enables	IEA	InterPro:IPR005794 and InterPro:IPR041711	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Mtfmt	Rat	methionyl-tRNA formyltransferase activity	enables	IEA	RHEA:24380	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Mtfmt	Rat	methionyl-tRNA formyltransferase activity	enables	ISS	UniProtKB:O77480	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Mtfmt	Rat	methionyl-tRNA formyltransferase activity	enables	ISO	MTFMT (Homo sapiens)	1624291	PMID:25288793	RGD	PMID:25288793
Mtfmt	Rat	transferase activity	enables	IEA	UniProtKB-KW:KW-0808	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfmt	Rat	folate metabolic pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00053
Mtfmt	Rat	glycine N-methyltransferase deficiency pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00222
Mtfmt	Rat	hereditary folate malabsorption pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00724
Mtfmt	Rat	homocystinuria pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00177
Mtfmt	Rat	hypermethioninemia pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00221
Mtfmt	Rat	hypermethioninemia pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00341
Mtfmt	Rat	methionine cycle/metabolic pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00033
Mtfmt	Rat	methotrexate pharmacodynamics pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00432
Mtfmt	Rat	methylenetetrahydrofolate reductase deficiency pathway		ISO	MTFMT (Homo sapiens)	10402751		SMPDB	SMP:00340

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Mtfmt	Rat	aminoacyl-tRNA biosynthetic pathway		IEA		6907045		KEGG	rno:00970
Mtfmt	Rat	folate mediated one-carbon metabolic pathway		IEA		6907045		KEGG	rno:00670

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:12477932	PMID:14651853	PMID:15489334	PMID:18614015

Mtfmt
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	74,848,936 - 74,866,987 (+)	NCBI		GRCr8
mRatBN7.2	8	65,953,787 - 65,971,841 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	65,953,767 - 65,971,841 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	71,466,158 - 71,484,219 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	69,739,169 - 69,757,231 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	67,608,805 - 67,626,822 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	70,952,209 - 70,986,393 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	70,952,203 - 70,986,408 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	70,644,131 - 70,674,636 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	69,683,737 - 69,701,721 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	69,702,790 - 69,720,775 (+)	NCBI
Celera	8	65,351,577 - 65,369,621 (+)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

MTFMT
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	65,001,512 - 65,029,639 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	65,001,512 - 65,029,639 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	65,293,850 - 65,321,977 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	63,081,901 - 63,109,018 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	42,172,045 - 42,200,175 (-)	NCBI		Celera
Cytogenetic Map	15	q22.31	NCBI
HuRef	15	42,118,760 - 42,146,953 (-)	NCBI		HuRef
CHM1_1	15	65,413,707 - 65,441,816 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	62,810,917 - 62,839,061 (-)	NCBI		T2T-CHM13v2.0

Mtfmt
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	65,343,064 - 65,360,336 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	65,343,064 - 65,360,336 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	65,435,782 - 65,453,054 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	65,435,782 - 65,453,054 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	65,283,589 - 65,300,861 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	65,233,788 - 65,250,408 (+)	NCBI		MGSCv36	mm8
Celera	9	62,665,176 - 62,682,547 (+)	NCBI		Celera
Cytogenetic Map	9	C	NCBI
cM Map	9	35.31	NCBI

Mtfmt
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	10,399,470 - 10,415,872 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	10,399,472 - 10,415,813 (+)	NCBI	ChiLan1.0	ChiLan1.0

MTFMT
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	54,248,598 - 54,275,521 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	58,419,167 - 58,447,109 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	43,942,227 - 43,969,182 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	62,225,620 - 62,253,612 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	62,225,620 - 62,253,612 (-)	Ensembl	panpan1.1		panPan2

MTFMT
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	29,388,600 - 29,415,578 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	29,388,649 - 29,450,430 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	29,316,102 - 29,343,074 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	29,575,346 - 29,602,377 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	29,575,395 - 29,638,967 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	29,508,217 - 29,535,124 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	29,569,540 - 29,596,594 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	29,810,600 - 29,837,619 (-)	NCBI		UU_Cfam_GSD_1.0

Mtfmt
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	107,486,806 - 107,504,465 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	25,335,068 - 25,352,480 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	25,334,544 - 25,352,520 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MTFMT
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	106,970,640 - 107,001,564 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	106,970,620 - 107,001,563 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	117,634,592 - 117,665,105 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MTFMT
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	18,556,747 - 18,583,528 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	18,556,791 - 18,583,446 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	122,849,535 - 122,876,821 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mtfmt
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	7,494,892 - 7,514,604 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	7,494,958 - 7,510,527 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Mtfmt
53 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	36
Count of miRNA genes:	31
Interacting mature miRNAs:	36
Transcripts:	ENSRNOT00000019671
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

RH132867

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	65,971,430 - 65,971,645 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	70,985,994 - 70,986,208	NCBI	Rnor6.0
Rnor_5.0	8	70,674,237 - 70,674,451	UniSTS	Rnor5.0
RGSC_v3.4	8	69,701,322 - 69,701,536	UniSTS	RGSC3.4
Celera	8	65,369,222 - 65,369,436	UniSTS
RH 3.4 Map	8	839.1	UniSTS
Cytogenetic Map	8	q24	UniSTS

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31


RefSeq Transcripts	NM_001009697	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039081507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063265522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487822	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005487823	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC088470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019671 ⟹ ENSRNOP00000019671

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	65,953,767 - 65,971,841 (+)	Ensembl
Rnor_6.0 Ensembl	8	70,952,203 - 70,986,408 (+)	Ensembl

RefSeq Acc Id:

NM_001009697 ⟹ NP_001009697

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	74,848,964 - 74,866,976 (+)	NCBI
mRatBN7.2	8	65,953,817 - 65,971,830 (+)	NCBI
Rnor_6.0	8	70,952,209 - 70,986,393 (+)	NCBI
Rnor_5.0	8	70,644,131 - 70,674,636 (+)	NCBI
RGSC_v3.4	8	69,683,737 - 69,701,721 (+)	RGD
Celera	8	65,351,577 - 65,369,621 (+)	RGD

Sequence:

show sequence

CCGCTGCGGGCCGAGGTGATGCTTCTTCCGCGGCGTTGCTGGGGTCCGTGGCTGGCGGGAAGGAGGCCACGCTGTTCCTGTCAGTCACCTGCTGGGTTCAGCGGGAAGGACCGCCGAAGCTCCCGGGT
CCGCGAGAAGCCACCTTGGCGGGTGCTGTTCTTCGGCACCGACCACTTTGCCCGGGAAGCCCTGCGGGCGCTGCACGCTGCCAGAGACAACAAAGAGGAAAAGTTAATTGAGAAACTGGAGGTTGTCA
CGGTGCCTTCGATATCCCCTAAAGGACTACCTGTGAAGCAATATGCTATACAGTCTCAGCTCCCGGTATATGAGTGGCCCGACATGGGATCCGGAGAATATGACGTTGGGGTAGTGGCTTCCTTTGGC
CGACTTTTGAGTGAGGCTCTTATTCTTAAATTTCCCTACGGAATACTGAATGTGCACCCCAGTTGCCTCCCGAGGTGGCGTGGTCCCGCTCCGATCATCCATACGGTGCTTCATGGAGACACAGTCAC
TGGCGTAACGATTATGCAAGTTAGACCCAAAAGATTCGATGTAGGCCCGATTCTCAAGCAGGAAACCGTCGCTGTTCCTCCCAAGAGCACGTCAAAGGAATTGGAAGCAGTGTTGTCAAAACTTGGTG
CCAACATGCTTATCTCGGTTTTGAAAAATTTGCCAGAAAGTCTGAACAATGGAAGGCCACAGCCAGCCGAGGGAGTGACGTATGCTCCCAAGGTTTCTGCTGGCACCAGCTGTGTCAAGTGGGAGGAG
CAAACCTCAGAGCAAGTACTCAGACTTCACCTTGCCATCGGGGACATAGTTCCACTGCAAACACTCTGGATGGAGAACACCGTTAAACTTCTGGATCTCGTAGAAGTTAACAACTCTATCCTTGCAGA
TCCGAAAGTGATGGGACAAACTGTGACTCCGGGGTCTGTGGTGTACCACAGACCGTCGCAAATGCTGCTAGTTCACTGCAAGGATGGCTGGATCGGGGTTCGATCAATAATGCACAAGAAAACACTAA
CAGCTACTGATTTCTACAATGGATATTTGCATGCGTGGTACCAGAAGAATTCCCATGCTTACCCAAGCCAGTGCAAGTTTCAGACTCTCAGACTTCCAACAAAGACGCAGCAGAAAACAAAGTTGTTG
CTGTGCAGTGCATTAAGTAGCTAGGAAGACCACAGACGAGGACCTGTTCACACTTGTAACTTATTAAAAGCTTTATTTACCAGCAACTGCTGTGATTTTGAAAGAAGATGACAGCTTGGGAGAAAGAG
AAAATGGTTATCAGGAGGTGGAAGTCTTACGCCCTCCATGGTGTGTATCAGTTAGGAGCAGACTTTTCTACTTGAATAACAAAAGTTTAAATAAAATTTGTATTTATAATGAAAAAAAAAAAAAAAAA
AAAAAAA

hide sequence

RefSeq Acc Id:

XM_039081506 ⟹ XP_038937434

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	74,849,035 - 74,866,987 (+)	NCBI
mRatBN7.2	8	65,953,888 - 65,971,841 (+)	NCBI

RefSeq Acc Id:

XM_039081507 ⟹ XP_038937435

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	74,850,372 - 74,866,987 (+)	NCBI
mRatBN7.2	8	65,955,228 - 65,971,841 (+)	NCBI

RefSeq Acc Id:

XM_063265522 ⟹ XP_063121592

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	74,848,936 - 74,861,699 (+)	NCBI

RefSeq Acc Id:

XR_005487822

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	74,848,936 - 74,866,702 (+)	NCBI
mRatBN7.2	8	65,953,787 - 65,971,555 (+)	NCBI

RefSeq Acc Id:

XR_005487823

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	74,848,936 - 74,866,701 (+)	NCBI
mRatBN7.2	8	65,953,787 - 65,971,554 (+)	NCBI


Protein RefSeqs	NP_001009697	(Get FASTA)	NCBI Sequence Viewer
	XP_038937434	(Get FASTA)	NCBI Sequence Viewer
	XP_038937435	(Get FASTA)	NCBI Sequence Viewer
	XP_063121592	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88470	(Get FASTA)	NCBI Sequence Viewer
	EDL95827	(Get FASTA)	NCBI Sequence Viewer
	EDL95828	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019671
GenBank Protein	Q5I0C5	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001009697 ⟸ NM_001009697

- UniProtKB:

Q5I0C5 (UniProtKB/Swiss-Prot), A6J5F4 (UniProtKB/TrEMBL), A0A8L2QA74 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MLLPRRCWGPWLAGRRPRCSCQSPAGFSGKDRRSSRVREKPPWRVLFFGTDHFAREALRALHAARDNKEEKLIEKLEVVTVPSISPKGLPVKQYAIQSQLPVYEWPDMGSGEYDVGVVASFGRLLSEA
LILKFPYGILNVHPSCLPRWRGPAPIIHTVLHGDTVTGVTIMQVRPKRFDVGPILKQETVAVPPKSTSKELEAVLSKLGANMLISVLKNLPESLNNGRPQPAEGVTYAPKVSAGTSCVKWEEQTSEQV
LRLHLAIGDIVPLQTLWMENTVKLLDLVEVNNSILADPKVMGQTVTPGSVVYHRPSQMLLVHCKDGWIGVRSIMHKKTLTATDFYNGYLHAWYQKNSHAYPSQCKFQTLRLPTKTQQKTKLLLCSALS
S

hide sequence

Ensembl Acc Id:

ENSRNOP00000019671 ⟸ ENSRNOT00000019671

RefSeq Acc Id:	XP_038937434 ⟸ XM_039081506
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038937435 ⟸ XM_039081507
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_063121592 ⟸ XM_063265522
- Peptide Label:	isoform X2

Protein Domains

Formyl transferase C-terminal Formyl transferase N-terminal

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q5I0C5-F1-model_v2	AlphaFold	Q5I0C5	1-385	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

RGD ID:

13696076

Promoter ID:

EPDNEW_R6600

Type:

multiple initiation site

Name:

Mtfmt_1

Description:

mitochondrial methionyl-tRNA formyltransferase

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	70,952,195 - 70,952,255	EPDNEW

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-30059	BioCyc
Ensembl Genes	ENSRNOG00000014602	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000019671	ENTREZGENE
Gene3D-CATH	3.40.50.12230	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7128152	IMAGE-MGC_LOAD
InterPro	Fmt	UniProtKB/Swiss-Prot
	Formyl_trans_C	UniProtKB/Swiss-Prot
	Formyl_transf_N	UniProtKB/Swiss-Prot
	Formyl_transf_N_sf	UniProtKB/Swiss-Prot
	Met-tRNA-FMT_N	UniProtKB/Swiss-Prot
KEGG Report	rno:315763	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:95129	IMAGE-MGC_LOAD
NCBI Gene	315763	ENTREZGENE
PANTHER	METHIONYL-TRNA FORMYLTRANSFERASE	UniProtKB/Swiss-Prot
	METHIONYL-TRNA FORMYLTRANSFERASE, MITOCHONDRIAL	UniProtKB/Swiss-Prot
Pfam	Formyl_trans_C	UniProtKB/Swiss-Prot
	Formyl_trans_N	UniProtKB/Swiss-Prot
PhenoGen	Mtfmt	PhenoGen
RatGTEx	ENSRNOG00000014602	RatGTEx
Superfamily-SCOP	SSF53328	UniProtKB/Swiss-Prot
UniProt	A0A8L2QA74	ENTREZGENE, UniProtKB/TrEMBL
	A6J5F4	ENTREZGENE, UniProtKB/TrEMBL
	A6J5F5_RAT	UniProtKB/TrEMBL
	FMT_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Mtfmt	mitochondrial methionyl-tRNA formyltransferase	RGD1309462	similar to RIKEN cDNA 2310020P08	Symbol and Name updated	1299863	APPROVED
2005-12-06	RGD1309462	similar to RIKEN cDNA 2310020P08	RGD1309462_predicted	similar to RIKEN cDNA 2310020P08 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-20	RGD1309462_predicted	similar to RIKEN cDNA 2310020P08 (predicted)	LOC315763_predicted		Symbol and Name status set to approved	1331353	APPROVED
2005-01-12	LOC315763_predicted	similar to RIKEN cDNA 2310020P08 (predicted)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)