Advanced Search (OLGA)

Gene: Btn1a1 (butyrophilin, subfamily 1, member A1) Rattus norvegicus

Subscribe to Updates

Analyze

Symbol:

Btn1a1

Name:

butyrophilin, subfamily 1, member A1

RGD ID:

1306984

Description:

Predicted to enable signaling receptor binding activity. Predicted to be involved in T cell receptor signaling pathway and regulation of cytokine production. Predicted to be active in external side of plasma membrane. Orthologous to human BTN1A1 (butyrophilin subfamily 1 member A1); INTERACTS WITH bisphenol A; gentamycin; indole-3-methanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

butyrophilin subfamily 1 member A1; LOC306956

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Candidate Gene For:

Eae32

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	42,080,217 - 42,092,286 (+)	NCBI		GRCr8
mRatBN7.2	17	41,653,499 - 41,664,246 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	41,654,249 - 41,664,272 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	41,734,973 - 41,742,726 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	43,339,034 - 43,346,787 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	41,613,472 - 41,621,229 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	43,899,155 - 43,909,042 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	43,900,450 - 43,909,627 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	45,755,210 - 45,765,018 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	48,856,129 - 48,863,883 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	48,858,965 - 48,866,724 (+)	NCBI
Celera	17	41,285,047 - 41,292,801 (+)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Btn1a1	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	Btn1a1 (Mus musculus)	6480464	[1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in increased expression of BTN1A1 mRNA	CTD	PMID:22206623
Btn1a1	Rat	all-trans-retinoic acid	multiple interactions	ISO	Btn1a1 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of BTN1A1 mRNA	CTD	PMID:36189433
Btn1a1	Rat	all-trans-retinoic acid	increases expression	ISO	Btn1a1 (Mus musculus)	6480464	Tretinoin results in increased expression of BTN1A1 mRNA	CTD	PMID:36189433
Btn1a1	Rat	arsane	affects methylation	ISO	BTN1A1 (Homo sapiens)	6480464	Arsenic affects the methylation of BTN1A1 gene	CTD	PMID:25304211
Btn1a1	Rat	arsenic atom	affects methylation	ISO	BTN1A1 (Homo sapiens)	6480464	Arsenic affects the methylation of BTN1A1 gene	CTD	PMID:25304211
Btn1a1	Rat	arsenite(3-)	increases methylation	ISO	BTN1A1 (Homo sapiens)	6480464	arsenite results in increased methylation of BTN1A1 promoter	CTD	PMID:23974009
Btn1a1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of BTN1A1 mRNA	CTD	PMID:25181051 and PMID:34947998
Btn1a1	Rat	bisphenol A	multiple interactions	ISO	BTN1A1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of BTN1A1 gene	CTD	PMID:31601247
Btn1a1	Rat	CGP 52608	multiple interactions	ISO	BTN1A1 (Homo sapiens)	6480464	CGP 52608 promotes the reaction [RORA protein binds to BTN1A1 gene]	CTD	PMID:28238834
Btn1a1	Rat	choline	multiple interactions	ISO	Btn1a1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of BTN1A1 gene	CTD	PMID:20938992
Btn1a1	Rat	epoxiconazole	increases expression	ISO	Btn1a1 (Mus musculus)	6480464	epoxiconazole results in increased expression of BTN1A1 mRNA	CTD	PMID:35436446
Btn1a1	Rat	folic acid	multiple interactions	ISO	Btn1a1 (Mus musculus)	6480464	[1 more ...	CTD	PMID:20938992 and PMID:22206623
Btn1a1	Rat	fulvestrant	multiple interactions	ISO	BTN1A1 (Homo sapiens)	6480464	[bisphenol A co-treated with Fulvestrant] results in decreased methylation of BTN1A1 gene	CTD	PMID:31601247
Btn1a1	Rat	gentamycin	increases expression	EXP		6480464	Gentamicins results in increased expression of BTN1A1 mRNA	CTD	PMID:33387578
Btn1a1	Rat	glycidyl methacrylate	decreases expression	ISO	BTN1A1 (Homo sapiens)	6480464	glycidyl methacrylate results in decreased expression of BTN1A1 protein	CTD	PMID:36641056
Btn1a1	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of BTN1A1 mRNA	CTD	PMID:22129741
Btn1a1	Rat	L-methionine	multiple interactions	ISO	Btn1a1 (Mus musculus)	6480464	[Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of BTN1A1 gene	CTD	PMID:20938992
Btn1a1	Rat	mono(2-ethylhexyl) phthalate	multiple interactions	ISO	Btn1a1 (Mus musculus)	6480464	[mono-(2-ethylhexyl)phthalate co-treated with Tretinoin] results in increased expression of BTN1A1 mRNA	CTD	PMID:36189433
Btn1a1	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine] results in increased expression of BTN1A1 mRNA	CTD	PMID:22129741
Btn1a1	Rat	PhIP	increases expression	EXP		6480464	2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in increased expression of BTN1A1 mRNA	CTD	PMID:15215175
Btn1a1	Rat	PhIP	decreases expression	EXP		6480464	2-amino-1-methyl-6-phenylimidazo(4 and 5-b)pyridine results in decreased expression of BTN1A1 mRNA	CTD	PMID:15215175
Btn1a1	Rat	resveratrol	multiple interactions	ISO	BTN1A1 (Homo sapiens)	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of BTN1A1 mRNA	CTD	PMID:23557933
Btn1a1	Rat	sodium arsenite	decreases expression	ISO	Btn1a1 (Mus musculus)	6480464	sodium arsenite results in decreased expression of BTN1A1 mRNA	CTD	PMID:37682722
Btn1a1	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	BTN1A1 (Homo sapiens)	6480464	theaflavin-3 and 3'-digallate affects the expression of BTN1A1 mRNA	CTD	PMID:34925699
Btn1a1	Rat	titanium dioxide	increases methylation	ISO	Btn1a1 (Mus musculus)	6480464	titanium dioxide results in increased methylation of BTN1A1 gene	CTD	PMID:35295148
Btn1a1	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of BTN1A1 mRNA	CTD	PMID:33387578
Btn1a1	Rat	XL147	multiple interactions	ISO	Btn1a1 (Mus musculus)	6480464	[N-nitroso-tris-chloroethylurea co-treated with XL147] results in decreased expression of BTN1A1 mRNA	CTD	PMID:27935865

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Btn1a1	Rat	regulation of cytokine production	involved_in	IBA	MGI:1354701 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Btn1a1	Rat	T cell receptor signaling pathway	involved_in	IBA	PANTHER:PTN008605761 and UniProtKB:O00481	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Btn1a1	Rat	external side of plasma membrane	is_active_in	IBA	MGI:1354701 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Btn1a1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Btn1a1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Btn1a1	Rat	protein binding	enables	ISO	BTN1A1 (Homo sapiens)	1624291	UniProtKB:Q6FHY5 more ...	RGD	PMID:32296183
Btn1a1	Rat	protein binding	enables	ISO	Btn1a1 (Mus musculus)	1624291	PR:Q00519 PMID:8541302	RGD	PMID:8541302
Btn1a1	Rat	signaling receptor binding	enables	IBA	MGI:1859549 more ...	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

PMID:16502470	PMID:20208008

Btn1a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	17	42,080,217 - 42,092,286 (+)	NCBI		GRCr8
mRatBN7.2	17	41,653,499 - 41,664,246 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	41,654,249 - 41,664,272 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	41,734,973 - 41,742,726 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	43,339,034 - 43,346,787 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	41,613,472 - 41,621,229 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	43,899,155 - 43,909,042 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	43,900,450 - 43,909,627 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	45,755,210 - 45,765,018 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	48,856,129 - 48,863,883 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	17	48,858,965 - 48,866,724 (+)	NCBI
Celera	17	41,285,047 - 41,292,801 (+)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

BTN1A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	26,500,303 - 26,510,425 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	26,500,303 - 26,510,425 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	26,500,531 - 26,510,653 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	26,608,550 - 26,618,629 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	26,584,518 - 26,618,629	NCBI
Celera	6	27,730,812 - 27,739,977 (+)	NCBI		Celera
Cytogenetic Map	6	p22.2	NCBI
HuRef	6	26,444,203 - 26,453,371 (+)	NCBI		HuRef
CHM1_1	6	26,503,594 - 26,512,752 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	26,368,710 - 26,378,831 (+)	NCBI		T2T-CHM13v2.0

Btn1a1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	23,641,154 - 23,650,084 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	23,641,162 - 23,650,071 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	23,456,984 - 23,465,914 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	23,456,992 - 23,465,901 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	23,548,861 - 23,557,770 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	23,464,471 - 23,473,374 (-)	NCBI		MGSCv36	mm8
Celera	13	23,689,704 - 23,698,615 (-)	NCBI		Celera
Cytogenetic Map	13	A3.1	NCBI
cM Map	13	9.72	NCBI

Btn1a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955483	392,749 - 409,947 (-)	NCBI	ChiLan1.0	ChiLan1.0

BTN1A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	41,146,301 - 41,156,092 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	37,147,062 - 37,157,585 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	26,333,369 - 26,342,997 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	26,990,950 - 27,001,087 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	26,990,950 - 27,001,087 (+)	Ensembl	panpan1.1		panPan2

BTN1A1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	24,282,445 - 24,290,261 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	24,282,590 - 24,289,167 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	24,139,250 - 24,150,265 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	24,465,808 - 24,476,825 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	24,465,881 - 24,472,586 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	24,246,903 - 24,257,628 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	24,298,542 - 24,309,603 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	25,763,416 - 25,774,439 (+)	NCBI		UU_Cfam_GSD_1.0

Btn1a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	1,403,569 - 1,436,841 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936671	2,209,410 - 2,217,982 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936671	2,209,521 - 2,217,981 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BTN1A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	20,977,442 - 20,985,070 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	20,977,940 - 20,985,300 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	22,299,271 - 22,307,236 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BTN1A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	45,704,449 - 45,714,311 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	45,705,703 - 45,713,944 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	26,435,817 - 26,445,335 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Btn1a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624756	357,047 - 362,415 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624756	356,124 - 362,425 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants in Btn1a1
36 total Variants

Predicted Target Of

	Summary Value
Count of predictions:	26
Count of miRNA genes:	25
Interacting mature miRNAs:	25
Transcripts:	ENSRNOT00000023622
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	7e-07	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
152023626	Bp403	Blood pressure QTL 403	3.86		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
152025238	Slep14	Serum leptin concentration QTL 14	4.62		blood leptin amount (VT:0005667)		17	24184890	79524188	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
152023740	Bp406	Blood pressure QTL 406	6.06		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
152023737	Bp405	Blood pressure QTL 405	5.06		arterial blood pressure trait (VT:2000000)			23930421	79524188	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
152023736	Bp404	Blood pressure QTL 404	3.78		arterial blood pressure trait (VT:2000000)		17	23930421	79524188	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
8	2	45	108	76	78	49	23	49	6	185	83	91	44	60	29


RefSeq Transcripts	NM_001170337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006253970	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600547	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017600549	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276435	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276436	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276438	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063276439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY327120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474064	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000023622 ⟹ ENSRNOP00000023622

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	41,654,249 - 41,664,272 (+)	Ensembl
Rnor_6.0 Ensembl	17	43,900,450 - 43,909,627 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105103 ⟹ ENSRNOP00000093963

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	41,654,249 - 41,664,272 (+)	Ensembl

RefSeq Acc Id:

NM_001170337 ⟹ NP_001163808

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	42,081,527 - 42,092,276 (+)	NCBI
mRatBN7.2	17	41,653,499 - 41,664,246 (+)	NCBI
Rnor_6.0	17	43,900,685 - 43,908,439 (+)	NCBI
Rnor_5.0	17	45,755,210 - 45,765,018 (+)	NCBI
RGSC_v3.4	17	48,856,129 - 48,863,883 (+)	RGD
Celera	17	41,285,047 - 41,292,801 (+)	RGD

Sequence:

show sequence

ATGGCAGTTCCCACCAACTCTTGTCCTTTGGTCTGTCTGCTCACCTTTACAGTCCTACAGCTACCTACGTTGGATTCAGCAGCTCCCTTCAATGTGACTGCACCTCAGGAGTCAGTGCTGGCCGTAGT
GGGTTCAGATGCGGAGCTGACCTGTCGCTTTTCCCCAAACGCAAGCTCAGAGCAAATGGAGCTGCTGTGGTTTCGACAGACGAGGTCGCCAGCGGTACTTCTGTACCGGGCTGGCCAGGAGCAGGAGG
GCGAGCAGATGACCGAGTACCACGGGAGGGCGACGCTGGTGACAGCCAGACTCCTAGACGGCCTCGCTACTCTGCGGATCCGAGGTGTCAGGGTCTCCGACCAGGGGCAATACCGGTGCTTTCTCAAA
GACAACGACGACTCCGAGGAGGCCGCTGTGCATCTCAAAGTGGCTGCTGTGGGCTCAGATCCTTACATCAGTATGAAGGTTCAAGAGAATGGAGACATGGAGCTGGAGTGCACCTCCTCTGGATGGTA
CCCAGAACCTCAGGTACAGTGGAGAACAGCCAACAGAGAGATGCTACCACCCACATCAGAGTCCAGGAATCCTGATACGGAAGGCTTGTTCACTGTGACAGCTTCTATGATGATCAGAGACAACTCCA
TAAAGAATATGTCCTGCTGCATTCAGAATATCCTCCTTGGCCAGGGGAAGGAAGTAGAGATCTCCTTACCAGCTCCCTTCTTGCCAAGGCTGACTCCTTGGATAGTAGCCTTGGCTATTGTCATATTG
GCCTTAGGGTTTCTCGCAATCGGGTCCATATTTTTCACTTGGAAACTATACAAGGAAAGATCTAGAGAGCGGAAGAAGGAATTTGGCTCTAAAGAGAGGCTTCTGGAAGAACTCAGATGCAAAAAGAC
TGCCCTTCATGAAGTTGATGTGACTCTGGATCCAGACACAGCTCACCCCCACCTCTTCCTGTATGAAGATTCAAAGTCGGTTCGATTGGAAGATTCACGTCAGATCCTGCCTGATAGACCAGAGAGAT
TTGACTCCTGGCCCTGCGTGTTGGGCCGTGAGACCTTTACTTCAGGGAGACATTATTGGGAGGTGGAGGTGGGAGATAGAACTGATTGGGCCATTGGTGTGTGTAGGGAGAATGTGGTGAAGAAAGGG
TTTGACCCCATGACTCCTGATAATGGGTTCTGGGCTGTGGAGTTGTATGGAAATGGGTACTGGGCCCTCACCCCACTCCGGACCCCTCTCCGGTTGGCAGGACCCCCTCGCCGAGTTGGGGTTTTTTT
GGACTATGAATTAGGAGACATTTCCTTCTACAATATGAGTGATGGATCTCTTATCTATGCTTTCCCTAGCATCTCTTTCTCTGGTCCCCTCCGTCCCTTCTTTTGTCTGTGGTCCTGTGGTAAAAAGC
CCCTAACCATCTGTCCAACCGCCAATGTGCCTGAGAAAATCACAGTCATTGCTAATGTCCAGGACAACATTCCCTTGTCCCCTCTGGGGGAAGGCTCTACTTCAGGAGACAAAGATAGTCTCCATTCT
AAACTGATACCTTTCTCACCTAGCCAAGCAGCACCTTAA

hide sequence

RefSeq Acc Id:

XM_063276434 ⟹ XP_063132504

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	42,080,217 - 42,092,286 (+)	NCBI

RefSeq Acc Id:

XM_063276435 ⟹ XP_063132505

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	42,081,216 - 42,092,286 (+)	NCBI

RefSeq Acc Id:

XM_063276436 ⟹ XP_063132506

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	42,080,217 - 42,092,286 (+)	NCBI

RefSeq Acc Id:

XM_063276437 ⟹ XP_063132507

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	42,080,217 - 42,092,286 (+)	NCBI

RefSeq Acc Id:

XM_063276438 ⟹ XP_063132508

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	42,080,217 - 42,092,286 (+)	NCBI

RefSeq Acc Id:

XM_063276439 ⟹ XP_063132509

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	17	42,081,217 - 42,092,286 (+)	NCBI


Protein RefSeqs	NP_001163808	(Get FASTA)	NCBI Sequence Viewer
	XP_063132504	(Get FASTA)	NCBI Sequence Viewer
	XP_063132505	(Get FASTA)	NCBI Sequence Viewer
	XP_063132506	(Get FASTA)	NCBI Sequence Viewer
	XP_063132507	(Get FASTA)	NCBI Sequence Viewer
	XP_063132508	(Get FASTA)	NCBI Sequence Viewer
	XP_063132509	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAQ90159	(Get FASTA)	NCBI Sequence Viewer
	EDL86598	(Get FASTA)	NCBI Sequence Viewer
	EDL86599	(Get FASTA)	NCBI Sequence Viewer
	EDL86600	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023622
	ENSRNOP00000023622.3
	ENSRNOP00000093963
	ENSRNOP00000093963.1

RefSeq Acc Id:	NP_001163808 ⟸ NM_001170337
- Peptide Label:	precursor
- UniProtKB:	F1LRV5 (UniProtKB/TrEMBL), Q6EHI2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAVPTNSCPLVCLLTFTVLQLPTLDSAAPFNVTAPQESVLAVVGSDAELTCRFSPNASSEQMELLWFRQTRSPAVLLYRAGQEQEGEQMTEYHGRATLVTARLLDGLATLRIRGVRVSDQGQYRCFLK DNDDSEEAAVHLKVAAVGSDPYISMKVQENGDMELECTSSGWYPEPQVQWRTANREMLPPTSESRNPDTEGLFTVTASMMIRDNSIKNMSCCIQNILLGQGKEVEISLPAPFLPRLTPWIVALAIVIL ALGFLAIGSIFFTWKLYKERSRERKKEFGSKERLLEELRCKKTALHEVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQILPDRPERFDSWPCVLGRETFTSGRHYWEVEVGDRTDWAIGVCRENVVKKG FDPMTPDNGFWAVELYGNGYWALTPLRTPLRLAGPPRRVGVFLDYELGDISFYNMSDGSLIYAFPSISFSGPLRPFFCLWSCGKKPLTICPTANVPEKITVIANVQDNIPLSPLGEGSTSGDKDSLHS KLIPFSPSQAAP hide sequence

Ensembl Acc Id:

ENSRNOP00000023622 ⟸ ENSRNOT00000023622

Ensembl Acc Id:

ENSRNOP00000093963 ⟸ ENSRNOT00000105103

RefSeq Acc Id:	XP_063132504 ⟸ XM_063276434
- Peptide Label:	isoform X1
- UniProtKB:	F1LRV5 (UniProtKB/TrEMBL), Q6EHI2 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063132508 ⟸ XM_063276438
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AGT1 (UniProtKB/TrEMBL), Q6EHI2 (UniProtKB/TrEMBL)

Protein Domains

B30.2/SPRY Ig-like

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1LRV5-F1-model_v2	AlphaFold	F1LRV5	1-524	view protein structure

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Database	Acc Id	Source(s)
BioCyc Gene	G2FUF-9344	BioCyc
Ensembl Genes	ENSRNOG00000017514	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023622	ENTREZGENE
	ENSRNOT00000023622.6	UniProtKB/TrEMBL
	ENSRNOT00000105103	ENTREZGENE
	ENSRNOT00000105103.1	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.920	UniProtKB/TrEMBL
	2.60.40.10	UniProtKB/TrEMBL
InterPro	B30.2/SPRY_sf	UniProtKB/TrEMBL
	B302/SPRY	UniProtKB/TrEMBL
	BTN3A2-like_Ig-C	UniProtKB/TrEMBL
	Butyrophylin	UniProtKB/TrEMBL
	ConA-like_dom	UniProtKB/TrEMBL
	Ig-like	UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/TrEMBL
	Ig_sub	UniProtKB/TrEMBL
	Ig_V-set	UniProtKB/TrEMBL
	IgSF_BTN/MOG	UniProtKB/TrEMBL
	PRY	UniProtKB/TrEMBL
	SPRY/PRY_BTN1/2	UniProtKB/TrEMBL
	SPRY_rcpt	UniProtKB/TrEMBL
KEGG Report	rno:306956	UniProtKB/TrEMBL
NCBI Gene	306956	ENTREZGENE
PANTHER	BUTYROPHILIN	UniProtKB/TrEMBL
	BUTYROPHILIN SUBFAMILY 1 MEMBER A1	UniProtKB/TrEMBL
Pfam	C2-set_3	UniProtKB/TrEMBL
	PRY	UniProtKB/TrEMBL
	SPRY	UniProtKB/TrEMBL
	V-set	UniProtKB/TrEMBL
PhenoGen	Btn1a1	PhenoGen
PRINTS	BUTYPHLNCDUF	UniProtKB/TrEMBL
PROSITE	B302_SPRY	UniProtKB/TrEMBL
	IG_LIKE	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017514	RatGTEx
SMART	IGv	UniProtKB/TrEMBL
	PRY	UniProtKB/TrEMBL
	SM00409	UniProtKB/TrEMBL
	SPRY	UniProtKB/TrEMBL
Superfamily-SCOP	ConA_like_lec_gl	UniProtKB/TrEMBL
	SSF48726	UniProtKB/TrEMBL
UniProt	A0A8I6AGT1	ENTREZGENE, UniProtKB/TrEMBL
	A6KLQ3_RAT	UniProtKB/TrEMBL
	A6KLQ5_RAT	UniProtKB/TrEMBL
	F1LRV5	ENTREZGENE, UniProtKB/TrEMBL
	Q6EHI2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2005-12-06	Btn1a1	butyrophilin, subfamily 1, member A1	Btn1a1_predicted	butyrophilin, subfamily 1, member A1 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Btn1a1_predicted	butyrophilin, subfamily 1, member A1 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailable


InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailable


Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
		Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable

Send us a Message