Advanced Search (OLGA)

Gene: Traf4 (Tnf receptor associated factor 4) Rattus norvegicus

Analyze

Symbol:

Traf4

Name:

Tnf receptor associated factor 4

RGD ID:

1306708

Description:

Predicted to enable several functions, including WW domain binding activity; enzyme binding activity; and tumor necrosis factor receptor binding activity. Predicted to be involved in cell surface receptor signaling pathway; positive regulation of JNK cascade; and regulation of canonical NF-kappaB signal transduction. Predicted to act upstream of or within respiratory gaseous exchange by respiratory system and respiratory tube development. Predicted to be located in nucleus. Predicted to be active in cytoplasm. Orthologous to human TRAF4 (TNF receptor associated factor 4); PARTICIPATES IN small cell lung carcinoma pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC303285; TNF receptor-associated factor 4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TRAF4 (TNF receptor associated factor 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Traf4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Traf4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TRAF4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TRAF4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Traf4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TRAF4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TRAF4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Traf4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Traf4 (TNF receptor associated factor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TRAF4 (TNF receptor associated factor 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Traf4 (TNF receptor associated factor 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	traf4a (tnf receptor-associated factor 4a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	traf4b (tnf receptor-associated factor 4b)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	traf4b (tnf receptor-associated factor 4b)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Traf4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Traf4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	trf-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector)
Caenorhabditis elegans (roundworm):	trf-1	Alliance	DIOPT (Hieranoid\|OMA\|OrthoFinder\|OrthoInspector)
Xenopus tropicalis (tropical clawed frog):	traf4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	traf4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	63,552,251 - 63,558,356 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	63,552,253 - 63,558,356 (-)	Ensembl				GRCr8
mRatBN7.2	10	63,054,169 - 63,060,284 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	63,054,181 - 63,060,284 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	67,686,461 - 67,692,566 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	67,191,815 - 67,197,920 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	62,662,821 - 62,668,926 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	65,418,688 - 65,424,802 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	65,418,700 - 65,424,802 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	66,209,815 - 66,215,919 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	64,471,018 - 64,477,122 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	62,031,830 - 62,037,936 (-)	NCBI		Celera
RGSC_v3.1	10	64,484,719 - 64,490,231 (+)	NCBI
Cytogenetic Map	10	q25	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Injuries (ISO)

lung adenocarcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

3,3'-diindolylmethane (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (EXP)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

amitrole (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP)

bisphenol F (EXP)

Bufotalin (ISO)

calcitriol (ISO)

capsaicin (ISO)

chlorpyrifos (ISO)

chromium(6+) (ISO)

cisplatin (ISO)

clothianidin (ISO)

clotrimazole (EXP)

coumestrol (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dioxygen (ISO)

divanadium pentaoxide (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

escitalopram (EXP)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenthion (ISO)

folic acid (ISO)

formaldehyde (ISO)

glyphosate (ISO)

hydroquinone (ISO)

inulin (ISO)

lead(0) (ISO)

leflunomide (ISO)

metformin (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

Mitotane (EXP)

nickel atom (ISO)

nimesulide (EXP)

Nor-9-carboxy-delta9-THC (ISO)

o-anisidine (ISO)

okadaic acid (ISO)

orphenadrine (EXP)

ozone (ISO)

p-menthan-3-ol (ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

propiconazole (EXP)

quercetin (ISO)

rotenone (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

sodium dodecyl sulfate (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trichloroethene (EXP)

urethane (ISO)

valproic acid (ISO)

vitamin E (ISO)

VX nerve agent (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic process (IEA)

cell surface receptor signaling pathway (IBA)

immune system process (IEA)

innate immune response (IEA)

positive regulation of JNK cascade (IEA,ISO)

positive regulation of protein kinase activity (ISO)

regulation of apoptotic process (IEA)

regulation of canonical NF-kappaB signal transduction (IBA)

respiratory gaseous exchange by respiratory system (ISO)

respiratory tube development (ISO)

signal transduction (IEA)

Cellular Component

bicellular tight junction (IEA)

cytoplasm (IBA,IEA,ISO)

cytoskeleton (IEA)

cytosol (IEA,ISO)

fibrillar center (IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

perinuclear region of cytoplasm (IEA)

plasma membrane (IEA)

Molecular Function

enzyme binding (IEA)

identical protein binding (IEA,ISO)

metal ion binding (IEA)

protein binding (ISO)

protein kinase binding (IEA,ISO)

signaling adaptor activity (IBA)

thioesterase binding (IEA,ISO)

transferase activity (IEA)

tumor necrosis factor receptor binding (IEA,ISO)

ubiquitin protein ligase binding (IEA,ISO)

WW domain binding (IEA,ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

small cell lung carcinoma pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Oncogenomics of c-Myc transgenic mice reveal novel regulators of extracellular signaling, angiogenesis and invasion with clinical significance for human lung adenocarcinoma.	Ciribilli Y and Borlak J, Oncotarget. 2017 Oct 23;8(60):101808-101831. doi: 10.18632/oncotarget.21981. eCollection 2017 Nov 24.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10934170	PMID:11279055	PMID:11728344	PMID:12477932	PMID:16157600	PMID:16246731	PMID:18087216	PMID:19937093	PMID:24311986	PMID:25416956	PMID:27107012	PMID:37642020

Genomics

Comparative Map Data

Traf4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	63,552,251 - 63,558,356 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	10	63,552,253 - 63,558,356 (-)	Ensembl				GRCr8
mRatBN7.2	10	63,054,169 - 63,060,284 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	63,054,181 - 63,060,284 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	10	67,686,461 - 67,692,566 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	67,191,815 - 67,197,920 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	62,662,821 - 62,668,926 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	65,418,688 - 65,424,802 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	65,418,700 - 65,424,802 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	10	66,209,815 - 66,215,919 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	10	64,471,018 - 64,477,122 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	10	62,031,830 - 62,037,936 (-)	NCBI		Celera
RGSC_v3.1	10	64,484,719 - 64,490,231 (+)	NCBI
Cytogenetic Map	10	q25	NCBI

TRAF4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	28,744,011 - 28,750,956 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	28,744,011 - 28,750,956 (+)	Ensembl			hg38	GRCh38
GRCh37	17	27,071,029 - 27,077,974 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	24,095,150 - 24,102,103 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	17	24,095,172 - 24,101,223	NCBI
Celera	17	23,930,211 - 23,937,232 (+)	NCBI		Celera
Cytogenetic Map	17	q11.2	NCBI
HuRef	17	23,279,873 - 23,286,815 (+)	NCBI		HuRef
CHM1_1	17	27,133,507 - 27,140,459 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	29,686,797 - 29,693,739 (+)	NCBI		T2T-CHM13v2.0

Traf4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	78,049,249 - 78,056,405 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	78,049,325 - 78,056,415 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	11	78,158,423 - 78,165,579 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	78,158,499 - 78,165,589 (-)	Ensembl			mm10	GRCm38
MGSCv37	11	77,971,925 - 77,979,052 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	11	77,973,506 - 77,981,722 (-)	NCBI		MGSCv36	mm8
Celera	11	85,658,165 - 85,665,259 (-)	NCBI		Celera
Cytogenetic Map	11	B5	NCBI
cM Map	11	46.74	NCBI

Traf4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955481	4,410,906 - 4,417,061 (-)	Ensembl
ChiLan1.0	NW_004955481	4,410,906 - 4,417,553 (-)	NCBI	ChiLan1.0	ChiLan1.0

TRAF4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	35,709,171 - 35,715,611 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	37,589,692 - 37,595,803 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	28,025,288 - 28,031,379 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	28,531,867 - 28,536,992 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	28,531,867 - 28,536,994 (-)	Ensembl			panPan2	panpan1.1

TRAF4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	42,933,638 - 42,940,033 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	42,933,750 - 42,939,520 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	42,089,448 - 42,095,453 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	43,751,853 - 43,757,883 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	43,751,838 - 43,757,883 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	42,534,768 - 42,540,773 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	42,826,987 - 42,832,980 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	42,905,534 - 42,911,765 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Traf4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	42,074,713 - 42,081,891 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936538	4,952,606 - 4,958,696 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936538	4,952,627 - 4,958,696 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRAF4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	44,975,632 - 44,987,104 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	12	44,975,639 - 44,981,650 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	46,959,386 - 46,999,501 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TRAF4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	22,507,915 - 22,513,956 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	22,507,835 - 22,515,335 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666075	7,607,085 - 7,613,159 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Traf4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624786	1,314,817 - 1,321,080 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624786	1,314,797 - 1,321,080 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Traf4
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	9	92,274,093 - 92,280,583 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Traf4
22 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	93
Count of miRNA genes:	74
Interacting mature miRNAs:	88
Transcripts:	ENSRNOT00000018468
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61441	Btemp1	Thermal response to stress QTL 1	4		body temperature trait (VT:0005535)	core body temperature (CMO:0001036)	10	35893451	64140567	Rat
1549846	Scl47	Serum cholesterol level QTL 47	3.6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	51071897	96071897	Rat
152025229	Scl83	Serum cholesterol level QTL 83	4.33		blood cholesterol amount (VT:0000180)		10	36211556	69161158	Rat
1578779	Tcas10	Tongue tumor susceptibility QTL 10	3.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	10	31796281	76796281	Rat
152025227	Bw195	Body weight QTL 195	5.73		body mass (VT:0001259)		10	47489017	69161158	Rat
1298069	Bp168	Blood pressure QTL 168	5.5		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	10	27023535	98502431	Rat
2293669	Bmd33	Bone mineral density QTL 33	4.5	0.0001	femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	10	27443787	72443787	Rat
152025224	Bw193	Body weight QTL 193	6.47		body mass (VT:0001259)		10	52162433	75582749	Rat
631552	Vetf2	Vascular elastic tissue fragility QTL 2	4.5	0.0002	aorta elastic tissue integrity trait (VT:0010556)	artery internal elastic lamina non-tumorous lesion count (CMO:0001913)	10	35509383	91417879	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1250554	64349221	Rat
631557	Bp136	Blood pressure QTL 136		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	56868440	76129113	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42546145	107713808	Rat
2293679	Bmd30	Bone mineral density QTL 30	3.5	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	58073360	103073360	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	19939207	64939207	Rat
70164	Bw21	Body weight QTL 21	4.36	0.00005	body mass (VT:0001259)	body weight (CMO:0000012)	10	54296336	99451733	Rat
61463	Bp12	Blood pressure QTL 12	6.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	41831278	86831278	Rat
1579919	Bp281	Blood pressure QTL 281		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50464802	95464802	Rat
2300218	Hpcl2	Hepatic cholesterol level QTL 2			liver cholesterol amount (VT:0010498)	liver cholesterol level (CMO:0001597)	10	45529164	96099749	Rat
8694173	Bw149	Body weight QTL 149	4.38	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	10	44939359	89939359	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	54296227	107713808	Rat
1598852	Anxrr19	Anxiety related response QTL 19	5.07		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	10	18668419	63668419	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50860288	95860288	Rat
724527	Bp148	Blood pressure QTL 148		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	28950353	73950353	Rat
1358897	Stresp6	Stress response QTL 6	4.17	0.022	blood norepinephrine amount (VT:0005663)	plasma norepinephrine level (CMO:0001010)	10	35893263	64653589	Rat
1331762	Rf40	Renal function QTL 40	3.873		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	10	29800910	64653589	Rat
2300171	Bmd58	Bone mineral density QTL 58	4.9	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	10	27443787	72443787	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14991535	86964295	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62556066	107556066	Rat
70188	BpQTLcluster1	Blood pressure QTL cluster 1	4.864		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	42823274	87823274	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62556066	107556066	Rat
9589030	Epfw9	Epididymal fat weight QTL 9	19.24	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	10	44939359	89939359	Rat
2293652	Bmd22	Bone mineral density QTL 22	4.9	0.0001	femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	10	27443787	72443787	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14991535	107556066	Rat
70198	BpQTLcluster9	Blood pressure QTL cluster 9	2.94		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	42823274	87823274	Rat
2306970	Anxrr22	Anxiety related response QTL 22	5.95		fear/anxiety-related behavior trait (VT:1000241)	number of periods of voluntary immobility (CMO:0001045)	10	61843496	98710773	Rat
2306787	Ean3	Experimental allergic neuritis QTL 3	3.1		nervous system integrity trait (VT:0010566)	body weight loss (CMO:0001399)	10	54296227	67476781	Rat
724556	Pur2	Proteinuria QTL 2	5.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	22931373	91127454	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6660923	73950353	Rat
2306792	Ean4	Experimental allergic neuritis QTL 4	4		nervous system integrity trait (VT:0010566)	IFNG-secreting splenocyte count (CMO:0002122)	10	49495492	94495492	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	52269185	107713808	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15533012	73695498	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	24662123	73695339	Rat
2298480	Eau7	Experimental allergic uveoretinitis QTL 7		0.0049	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	10	35509383	80509383	Rat
70363	Bp71	Blood pressure QTL 71		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	61843496	106843496	Rat
61402	Niddm3	Non-insulin dependent diabetes mellitus QTL 3	4.58		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	61843633	83061236	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29800910	91417879	Rat
2313087	Bmd80	Bone mineral density QTL 80	3.2	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	10	20110614	65110614	Rat
2289985	Bp305	Blood pressure QTL 305			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	29076978	74076978	Rat
631530	Tls3	T-lymphoma susceptibility QTL 3	0	0.0001	thymus integrity trait (VT:0010555)	percentage of study population developing T-cell lymphomas during a period of time (CMO:0001911)	10	27587226	96099902	Rat
1354608	Cm33	Cardiac mass QTL 33	2.8		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	10	55307972	93608131	Rat
1558643	Cm44	Cardiac mass QTL 44	4.8	0.0000368	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	61843496	100198886	Rat
8552805	Bw145	Body weight QTL 145	2.2		body mass (VT:0001259)	change in body weight to body weight ratio (CMO:0002216)	10	43608793	88608793	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23948641	107713808	Rat
1331839	Eae18b	Experimental allergic encephalomyelitis QTL 18b	5.8	0.03	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	10	61746532	68282731	Rat
2293705	Bmd25	Bone mineral density QTL 25	7.1	0.0001	femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	27443787	72443787	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40535708	107713808	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14991535	107713808	Rat
7207811	Bmd90	Bone mineral density QTL 90	5.2		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	10	49943710	94943710	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40535708	107713808	Rat
631526	Bp76	Blood pressure QTL 76		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	61843633	67241334	Rat
1576311	Pia26	Pristane induced arthritis QTL 26			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	31129113	76129113	Rat
7411614	Foco18	Food consumption QTL 18		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	44939359	89939359	Rat
6893336	Cm75	Cardiac mass QTL 75	0.1	0.87	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	61843496	100198886	Rat
631547	Bp87	Blood pressure QTL 87	4.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	47869129	92869129	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6864618	96620484	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	50604677	95604677	Rat
12880050	Am10	Aortic mass QTL 10		0.016	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	39503487	84503487	Rat
6893342	Cm78	Cardiac mass QTL 78	0.1	0.88	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	10	35509383	88177745	Rat
634354	Rends3	Renal damage susceptibility QTL 3		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	10	61997479	106997479	Rat
2313055	Bw96	Body weight QTL 96	3.6	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	10	20110614	65110614	Rat
631542	Bp82	Blood pressure QTL 82	6.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	27023535	99451848	Rat

Markers in Region

RH128203

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	63,054,271 - 63,054,479 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	65,418,791 - 65,418,998	NCBI	Rnor6.0
Rnor_5.0	10	66,215,619 - 66,215,826	UniSTS	Rnor5.0
RGSC_v3.4	10	64,476,822 - 64,477,029	UniSTS	RGSC3.4
Celera	10	62,031,923 - 62,032,130	UniSTS
Cytogenetic Map	10	q25	UniSTS

UniSTS:547166

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	63,054,716 - 63,056,112 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	65,419,236 - 65,420,631	NCBI	Rnor6.0
Rnor_5.0	10	66,213,986 - 66,215,381	UniSTS	Rnor5.0
Celera	10	62,032,368 - 62,033,763	UniSTS
Cytogenetic Map	10	q25	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	161	91	90	59	92	59	6	356	192	11	140	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC162047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000018468 ⟹ ENSRNOP00000018468

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	63,552,253 - 63,558,356 (-)	Ensembl
mRatBN7.2 Ensembl	10	63,054,181 - 63,060,284 (-)	Ensembl
Rnor_6.0 Ensembl	10	65,418,700 - 65,424,802 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112586 ⟹ ENSRNOP00000093446

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	10	63,552,253 - 63,556,365 (-)	Ensembl
mRatBN7.2 Ensembl	10	63,054,181 - 63,060,284 (-)	Ensembl

RefSeq Acc Id:

NM_001107017 ⟹ NP_001100487

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	63,552,251 - 63,558,356 (-)	NCBI
mRatBN7.2	10	63,054,179 - 63,060,284 (-)	NCBI
Rnor_6.0	10	65,418,698 - 65,424,802 (-)	NCBI
Rnor_5.0	10	66,209,815 - 66,215,919 (+)	NCBI
RGSC_v3.4	10	64,471,018 - 64,477,122 (+)	RGD
Celera	10	62,031,830 - 62,037,936 (-)	RGD

Sequence:

show sequence

CGCGGCCCGAGCGAGGCGCGCGGGCTGTGGGGCCGCCGCGTGCCCGGCCCCGCTCGCCCGTGCC
CGGCGCCCGCCCGCCATGCCCGGCTTCGACTACAAGTTCCTGGAGAAGCCCAAGCGGCGGCTGC
TGTGCCCACTGTGCGGGAAACCCATGCGCGAGCCTGTGCAGGTGTCCACTTGCGGCCACCGCTT
CTGCGACACCTGCCTGCAGGAGTTCCTCAGTGAAGGAGTCTTCAAATGCCCTGAAGACCAGCTT
CCTCTGGACTATGCCAAGATCTACCCGGACCCAGAGCTGGAGGTGCAGGTGTTAGGCTTGGCTA
TACGCTGCATCCACAGTGAGGAGGGCTGCCGCTGGAGCGGGCCACTTCGTCACCTACAGGGCCA
CTTGAACACTTGCAGCTTCAATGTAGTCCCCTGCCCGAATCGCTGCCCGGCCAAGCTGAGCCGG
CGCGACCTGCCCGCCCACCTGCAGCACGACTGCCCTAAGCGCCGCCTCAAGTGTGAATTCTGTG
GTTGTGACTTCAGTGGGGAGGCCTACGAGAGTCACGAGGGTGTGTGCCCCCAAGAGAGTGTGTA
CTGTGAGAACAAGTGTGGTGCCCGCATGATGAGGCGACTGTTGGCCCAGCACGCCACTTCTGAG
TGCCCCAAGCGCACCCAGCCCTGTGCCTACTGTACCAAGGAGTTTGTTTATGACACCATCCAGA
GCCACCAGTACCAGTGCCCACGCCTGCCTGTTCCCTGCCCCAACCAGTGTGGAGTGGGCACTGT
GGCCCGGGAGGACCTGCCCACCCATCTGAAGGATAGCTGCAGCACTGCCTTCGTGCTCTGCCCT
TTCAAAGAGTCTGGCTGCAAGCACAGGTGCCCTAAGCTGGCAATGGGACGTCATGTGGAGGAAA
GTGTAAAGCCACATCTGGCTATGATGTGCGCCCTGGTGAGCCGGCAGCGGCAAGAGCTGCAGGA
GCTGCGCAGAGAGCTGGAGGAGCTATCTGTGGGTAGTGATGGAGTGCTCATCTGGAAGATCGGC
AGCTATGGGCGTCGCCTACAGGAGGCCAAGGCCAAGCCTAACCTGGAGTGCTTCAGCCCAGCCT
TCTATACACATAAGTACGGTTACAAGCTGCAGGTGTCTGCGTTCCTTAACGGCAATGGCAGTGG
GGAGGGTACGCATCTCTCCATCTACATCCGTGTGCTGCCAGGCGCCTTTGACAATCTCCTCGAG
TGGCCTTTTGCACGACGGGTCACCTTCTCCCTGCTGGATCAGAGTGACCCAGGTTTGGCTAAGC
CACAGCATGTCACGGAGACCTTCCACCCTGATCCAAACTGGAAGAACTTCCAGAAGCCTGGCAC
TTGGCGAGGTTCCCTGGATGAGAGTTCTCTGGGCTTTGGCTACCCCAAATTCATTTCCCACCAG
GACATCCGAAAACGAAATTACGTGCGGGATGATGCAGTTTTCATCCGTGCCTCTGTCGAACTGC
CCCGGAAGATCCTCAGCTGAGAGTAGATAGAGCCTTTTGGCTTCAAGTGGGAAGGGAGGTGGGA
CAGGATCTCAGGCACTGGCTGGAACTGGATTGGGGGCCGGACCTCCTTTCAGCTTCTTTTGCCT
AGGTTGTTAGCCCATTCTCCCTACCACCACCACCACCACCCCTACCCCTCAGGTGCCTCCAATT
GGTGCTTCAGCCCTGGCCCCTGGGGGGAGCAGGTCTCGGGGTTATCAAGGGCTGGAAATGTGAT
CCCAGGGCCTGTCTCCCCTCCTGGGCAGGGCGGACATGCCTTGGTGCCAGCCACGTTCTACCTG
GACTGAGGTGCCTGCTCAGGTGCTATATCCCAAGAGCCATAGTGGGGGTGGGAGGTATTGGCAA
CGGGAGGGGTAGGTATAAGAATCTGCCTTGAGATTACCTTCTCTTTCCATTCACCCAGTGGCGC
CCTCTCTGGTTATTTATTTCTCTAGTGCTAGGAGGGCACAGCAGGGGAACTCTGATTTTTAATA
AATCCTGAATTGTATTTATTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100487	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI62047	(Get FASTA)	NCBI Sequence Viewer
	EDM05315	(Get FASTA)	NCBI Sequence Viewer
	EDM05316	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000018468
	ENSRNOP00000018468.4
	ENSRNOP00000093446.2

RefSeq Acc Id:

NP_001100487 ⟸ NM_001107017

- UniProtKB:

B1WC90 (UniProtKB/TrEMBL), F7F523 (UniProtKB/TrEMBL), A0A8I6AJ00 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPGFDYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYA
KIYPDPELEVQVLGLAIRCIHSEEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPA
HLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRT
QPCAYCTKEFVYDTIQSHQYQCPRLPVPCPNQCGVGTVAREDLPTHLKDSCSTAFVLCPFKESG
CKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQELRRELEELSVGSDGVLIWKIGSYGRR
LQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFAR
RVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR
NYVRDDAVFIRASVELPRKILS

hide sequence

Ensembl Acc Id:

ENSRNOP00000018468 ⟸ ENSRNOT00000018468

Ensembl Acc Id:

ENSRNOP00000093446 ⟸ ENSRNOT00000112586

Protein Domains

MATH RING-type TRAF-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WC90-F1-model_v2	AlphaFold	B1WC90	1-470	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13697466

Promoter ID:

EPDNEW_R7991

Type:

multiple initiation site

Name:

Traf4_1

Description:

Tnf receptor associated factor 4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	10	65,424,828 - 65,424,888	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306708	AgrOrtholog
BioCyc Gene	G2FUF-24093	BioCyc
Ensembl Genes	ENSRNOG00000013169	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000018468	ENTREZGENE
	ENSRNOT00000018468.7	UniProtKB/TrEMBL
	ENSRNOT00000112586.2	UniProtKB/TrEMBL
Gene3D-CATH	3.30.40.10	UniProtKB/TrEMBL
	Apoptosis, Tumor Necrosis Factor Receptor Associated Protein 2, Chain A	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7107394	IMAGE-MGC_LOAD
InterPro	MATH	UniProtKB/TrEMBL
	TNF_recpt_TRAF	UniProtKB/TrEMBL
	TRAF-like	UniProtKB/TrEMBL
	TRAF4_MATH	UniProtKB/TrEMBL
	TRAF_MEP1_MATH_dom	UniProtKB/TrEMBL
	Znf_C3HC4_RING-type	UniProtKB/TrEMBL
	Znf_RING	UniProtKB/TrEMBL
	Znf_RING/FYVE/PHD	UniProtKB/TrEMBL
	Znf_RING_CS	UniProtKB/TrEMBL
	Znf_TRAF	UniProtKB/TrEMBL
KEGG Report	rno:303285	UniProtKB/TrEMBL
MGC_CLONE	MGC:188008	IMAGE-MGC_LOAD
NCBI Gene	303285	ENTREZGENE
PANTHER	TNF RECEPTOR ASSOCIATED FACTOR	UniProtKB/TrEMBL
	TNF RECEPTOR-ASSOCIATED FACTOR 4	UniProtKB/TrEMBL
Pfam	TRAF-mep_MATH	UniProtKB/TrEMBL
	zf-C3HC4	UniProtKB/TrEMBL
	zf-TRAF	UniProtKB/TrEMBL
PhenoGen	Traf4	PhenoGen
PIRSF	TRAF	UniProtKB/TrEMBL
PROSITE	MATH	UniProtKB/TrEMBL
	ZF_RING_1	UniProtKB/TrEMBL
	ZF_RING_2	UniProtKB/TrEMBL
	ZF_TRAF	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000013169	RatGTEx
SMART	MATH	UniProtKB/TrEMBL
	RING	UniProtKB/TrEMBL
Superfamily-SCOP	RING/U-box	UniProtKB/TrEMBL
	TRAF domain-like	UniProtKB/TrEMBL
UniProt	A0A8I6AJ00	ENTREZGENE, UniProtKB/TrEMBL
	B1WC90	ENTREZGENE, UniProtKB/TrEMBL
	F7F523	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-04-30	Traf4	Tnf receptor associated factor 4	Traf4_predicted	Tnf receptor associated factor 4 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Traf4_predicted	Tnf receptor associated factor 4 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)