Car9 (carbonic anhydrase 9) - Rat Genome Database

Name: Car9
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Car9 (carbonic anhydrase 9) Rattus norvegicus

Analyze

Symbol:

Car9

Name:

carbonic anhydrase 9

RGD ID:

1306426

Description:

Predicted to enable carbonate dehydratase activity; molecular function activator activity; and zinc ion binding activity. Involved in response to hypoxia; response to testosterone; and response to xenobiotic stimulus. Located in basolateral plasma membrane. Human ortholog(s) of this gene implicated in hepatitis B; lung non-small cell carcinoma; and renal cell carcinoma. Orthologous to human CA9 (carbonic anhydrase 9); PARTICIPATES IN hypoxia inducible factor pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; acetamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Ca9; carbonic anhydrase IX; LOC313495

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CA9 (carbonic anhydrase 9)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Car9 (carbonic anhydrase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ca9 (carbonic anhydrase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	CA9 (carbonic anhydrase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CA9 (carbonic anhydrase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ca9 (carbonic anhydrase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	CA9 (carbonic anhydrase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CA9 (carbonic anhydrase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ca9 (carbonic anhydrase 9)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	CA9 (carbonic anhydrase 9)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Car9 (carbonic anhydrase 9)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ca9 (carbonic anhydrase IX)	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18673	Alliance	DIOPT (Ensembl Compara\|InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG18672	Alliance	DIOPT (Ensembl Compara\|InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG3669	Alliance	DIOPT (Ensembl Compara\|InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5379	Alliance	DIOPT (Ensembl Compara\|InParanoid\|SonicParanoid)
Drosophila melanogaster (fruit fly):	caix	Alliance	DIOPT (Ensembl Compara\|InParanoid\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,559,024 - 62,565,626 (+)	NCBI		GRCr8
mRatBN7.2	5	57,763,234 - 57,769,838 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	57,763,206 - 57,769,838 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	59,743,112 - 59,749,748 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,561,925 - 61,568,564 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,533,190 - 61,539,753 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,008,277 - 59,015,535 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,008,933 - 59,015,528 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	63,533,527 - 63,540,129 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	59,986,413 - 59,993,015 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	59,986,589 - 59,992,484 (+)	NCBI
Celera	5	56,343,808 - 56,350,416 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acromesomelic dysplasia, Maroteaux type (ISO)

Anaplasia (ISO)

anauxetic dysplasia (ISO)

autosomal recessive distal hereditary motor neuronopathy 2 (ISO)

breast carcinoma (ISO)

chronic myeloid leukemia (ISO)

distal arthrogryposis type 1A (ISO)

Ductal Carcinoma (ISO)

ductal carcinoma in situ (ISO)

endometrial hyperplasia (ISO)

Endometrioid Carcinomas (ISO)

Experimental Mammary Neoplasms (IEP)

Fibrosis (ISO)

frontotemporal dementia and/or amyotrophic lateral sclerosis 6 (ISO)

galactosemia (ISO)

genetic disease (ISO)

hepatitis B (ISO)

hepatocellular carcinoma (ISO)

hyperphosphatasia with impaired intellectual development syndrome 2 (ISO)

Hypoxia (ISO)

lung non-small cell carcinoma (ISO)

Lymphatic Metastasis (ISO)

Lynch syndrome (ISO)

Metaplasia (ISO)

primary ciliary dyskinesia (ISO)

pulmonary hypertension (ISO)

renal cell carcinoma (ISO)

Right Ventricular Hypertrophy (IEP)

transitional cell carcinoma (ISO)

urinary bladder cancer (ISO)

Uterine Cervical Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,10-phenanthroline (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

4-methylumbelliferyl beta-D-galactoside (ISO)

4-nitrophenol (ISO)

acetamide (EXP)

acetazolamide (ISO)

acrylamide (ISO)

amphotericin B (ISO)

ampicillin (ISO)

antirheumatic drug (ISO)

Archazolid B (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

betulin (ISO)

betulinic acid (ISO)

bezafibrate (ISO)

bisphenol A (EXP,ISO)

bleomycin A5 (ISO)

bortezomib (ISO)

butanal (ISO)

butyric acid (ISO)

calcitriol (ISO)

captan (ISO)

carbonates (ISO)

CAY10591 (ISO)

CGP 52608 (ISO)

chloric acid (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

clofibrate (ISO)

cobalt atom (ISO)

cobalt dichloride (EXP,ISO)

cobalt(2+) sulfate (ISO)

crocidolite asbestos (ISO)

curcumin (EXP)

cyclosporin A (ISO)

deguelin (ISO)

desferrioxamine B (ISO)

diarsenic trioxide (ISO)

dimethylarsinous acid (ISO)

dioxygen (EXP,ISO)

doxorubicin (ISO)

ethanol (ISO)

fenofibrate (ISO)

folpet (ISO)

gemfibrozil (ISO)

Genipin (ISO)

heptanal (ISO)

hexanal (ISO)

hydroquinone (ISO)

iron(III) citrate (ISO)

L-ascorbic acid (ISO)

lead(0) (ISO)

LY294002 (ISO)

molybdate (ISO)

N-Nitrosopyrrolidine (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

nitric acid (ISO)

Nonidet P-40 (ISO)

O-methyleugenol (ISO)

octanal (ISO)

oryzalin (ISO)

oxaliplatin (ISO)

paracetamol (EXP,ISO)

pentanal (ISO)

perchlorate (ISO)

perfluorooctanoic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

propanal (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

serpentine asbestos (ISO)

silibinin (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium dichromate (ISO)

sotorasib (ISO)

sulfamic acid (ISO)

sulfates (ISO)

sulindac (ISO)

temozolomide (ISO)

trametinib (ISO)

tributylstannane (EXP)

Triptolide (ISO)

tungstate (ISO)

Tungsten carbide (ISO)

urethane (ISO)

valproic acid (EXP)

vorinostat (ISO)

zinc dichloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

morphogenesis of an epithelium (ISO)

one-carbon metabolic process (IBA)

response to hypoxia (IEP)

response to testosterone (IEP)

response to xenobiotic stimulus (IEP)

secretion (ISO)

Cellular Component

basolateral plasma membrane (IDA)

plasma membrane (IBA,ISO)

Molecular Function

carbonate dehydratase activity (IBA,ISO)

molecular function activator activity (ISO)

protein binding (ISO)

zinc ion binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

hypoxia inducible factor pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Suppression of the hypoxia-inducible factor-1 response in cervical carcinoma xenografts by proteasome inhibitors.	Birle DC and Hedley DW, Cancer Res. 2007 Feb 15;67(4):1735-43.
2.	Hypomethylation of the MN/CA9 promoter and upregulated MN/CA9 expression in human renal cell carcinoma.	Cho M, etal., Br J Cancer. 2001 Aug 17;85(4):563-7.
3.	Immunotargeting of human cervical carcinoma xenograft expressing CA IX tumor-associated antigen by 125I-labeled M75 monoclonal antibody.	Chrastina A, etal., Neoplasma. 2003;50(1):13-21.
4.	New Gene Variants Associated with the Risk of Chronic HBV Infection.	Fan M, etal., Virol Sin. 2020 Aug;35(4):378-387. doi: 10.1007/s12250-020-00200-x. Epub 2020 Apr 15.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Induction of carbonic anhydrase IX by hypoxia and chemical disruption of oxygen sensing in rat fibroblasts and cardiomyocytes.	Holotnakova T, etal., Pflugers Arch. 2008 May;456(2):323-37. Epub 2007 Dec 11.
8.	p16 is consistently expressed in endometrial tubal metaplasia.	Horree N, etal., Cell Oncol. 2007;29(1):37-45.
9.	Hypoxia and angiogenesis in endometrioid endometrial carcinogenesis.	Horree N, etal., Cell Oncol. 2007;29(3):219-27.
10.	GLUT1 and CAIX as intrinsic markers of hypoxia in bladder cancer: relationship with vascularity and proliferation as predictors of outcome of ARCON.	Hoskin PJ, etal., Br J Cancer. 2003 Oct 6;89(7):1290-7.
11.	Carbonic anhydrase IX, a marker of hypoxia: correlation with clinical outcome in transitional cell carcinoma of the bladder.	Hussain SA, etal., Oncol Rep. 2004 May;11(5):1005-10.
12.	Response of CAIX and CAXII to in vitro re-oxygenation and clinical significance of the combined expression in NSCLC patients.	Ilie M, etal., Lung Cancer. 2013 Oct;82(1):16-23. doi: 10.1016/j.lungcan.2013.07.005. Epub 2013 Jul 30.
13.	pH regulators to target the tumor immune microenvironment in human hepatocellular carcinoma.	Kuchuk O, etal., Oncoimmunology. 2018 Mar 26;7(7):e1445452. doi: 10.1080/2162402X.2018.1445452. eCollection 2018.
14.	Tumor carbonic anhydrase 9 expression is associated with the presence of lymph node metastases in uterine cervical cancer.	Lee S, etal., Cancer Sci. 2007 Mar;98(3):329-33. Epub 2007 Jan 12.
15.	Hypoxia and its downstream targets in DMBA induced mammary carcinoma: protective role of Semecarpus anacardium nut extract.	Mathivadhani P, etal., Chem Biol Interact. 2007 Apr 5;167(1):31-40. Epub 2007 Jan 10.
16.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
17.	Carbonic anhydrase IX is highly expressed in hereditary nonpolyposis colorectal cancer.	Niemelä AM, etal., Cancer Epidemiol Biomarkers Prev. 2007 Sep;16(9):1760-6. doi: 10.1158/1055-9965.EPI-07-0080.
18.	Carbonic anhydrase IX, MN/CA IX: analysis of stomach complementary DNA sequence and expression in human and rat alimentary tracts.	Pastorekova S, etal., Gastroenterology. 1997 Feb;112(2):398-408.
19.	Low CAIX expression and absence of VHL gene mutation are associated with tumor aggressiveness and poor survival of clear cell renal cell carcinoma.	Patard JJ, etal., Int J Cancer. 2008 May 7;123(2):395-400.
20.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
21.	GOA pipeline	RGD automated data pipeline
22.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
23.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
24.	Comprehensive gene review and curation	RGD comprehensive gene curation
25.	Testosterone-stimulated growth of the rat prostate may be driven by tissue hypoxia and hypoxia-inducible factor-1alpha.	Rudolfsson SH and Bergh A, J Endocrinol. 2008 Jan;196(1):11-9.
26.	Induction of antigen specific cellular immunity by vaccination with peptides from MN/CA IX in renal cell carcinoma.	Shimizu K, etal., Oncol Rep. 2003 Sep-Oct;10(5):1307-11.
27.	Changes in the expression and/or activation of regulatory proteins in rat hearts adapted to chronic hypoxia.	Strniskova M, etal., Gen Physiol Biophys. 2006 Mar;25(1):25-41.
28.	HIF-1alpha and CA IX staining in invasive breast carcinomas: prognosis and treatment outcome.	Trastour C, etal., Int J Cancer. 2007 Apr 1;120(7):1451-8.
29.	Gene Expression Profiles Associated with the Presence of a Fibrotic Focus and the Growth Pattern in Lymph Node-Negative Breast Cancer.	Van den Eynden GG, etal., Clin Cancer Res. 2008 May 15;14(10):2944-2952.
30.	Soluble form of carbonic anhydrase IX (CA IX) in the serum and urine of renal carcinoma patients.	Zavada J, etal., Br J Cancer. 2003 Sep 15;89(6):1067-71.

Additional References at PubMed

PMID:16217040	PMID:16831598	PMID:22087255	PMID:22538240	PMID:28940640	PMID:29631360	PMID:34231059	PMID:34251286

Genomics

Comparative Map Data

Car9
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	62,559,024 - 62,565,626 (+)	NCBI		GRCr8
mRatBN7.2	5	57,763,234 - 57,769,838 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	57,763,206 - 57,769,838 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	59,743,112 - 59,749,748 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	61,561,925 - 61,568,564 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	61,533,190 - 61,539,753 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	59,008,277 - 59,015,535 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	59,008,933 - 59,015,528 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	63,533,527 - 63,540,129 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	59,986,413 - 59,993,015 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	59,986,589 - 59,992,484 (+)	NCBI
Celera	5	56,343,808 - 56,350,416 (+)	NCBI		Celera
Cytogenetic Map	5	q22	NCBI

CA9
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	35,673,928 - 35,681,159 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	35,673,928 - 35,681,159 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	35,673,925 - 35,681,156 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	35,663,915 - 35,671,152 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	35,663,914 - 35,671,152	NCBI
Celera	9	35,607,463 - 35,614,702 (+)	NCBI		Celera
Cytogenetic Map	9	p13.3	NCBI
HuRef	9	35,629,523 - 35,636,764 (+)	NCBI		HuRef
CHM1_1	9	35,673,743 - 35,680,984 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	35,694,579 - 35,701,811 (+)	NCBI		T2T-CHM13v2.0

Car9
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	43,507,026 - 43,513,729 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	43,506,966 - 43,513,729 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	43,507,026 - 43,513,729 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	43,506,966 - 43,513,729 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	43,519,898 - 43,526,597 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	43,528,107 - 43,534,829 (+)	NCBI		MGSCv36	mm8
Celera	4	43,540,895 - 43,547,584 (+)	NCBI		Celera
Cytogenetic Map	4	A5	NCBI
cM Map	4	23.05	NCBI

Ca9
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955472	619,245 - 625,051 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955472	619,084 - 625,570 (-)	NCBI	ChiLan1.0	ChiLan1.0

CA9
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	88,906,190 - 88,913,457 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	88,912,119 - 88,919,393 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	35,525,877 - 35,533,159 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	36,328,205 - 36,335,474 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	36,328,303 - 36,335,340 (+)	Ensembl	panpan1.1		panPan2

CA9
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	52,205,619 - 52,211,281 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	52,205,668 - 52,211,267 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	50,773,252 - 50,778,851 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	53,270,515 - 53,276,220 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	53,270,614 - 53,276,220 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	51,815,201 - 51,820,803 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	51,798,686 - 51,804,281 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	52,500,820 - 52,506,421 (+)	NCBI		UU_Cfam_GSD_1.0

Ca9
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	167,124,669 - 167,131,057 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936524	3,672,541 - 3,678,433 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936524	3,672,393 - 3,678,630 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CA9
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	236,394,306 - 236,400,822 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	236,393,727 - 236,400,994 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	264,118,816 - 264,126,024 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CA9
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	44,921,530 - 44,929,504 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	44,921,665 - 44,928,831 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	42,026,370 - 42,034,593 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ca9
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624868	5,109,846 - 5,116,949 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624868	5,110,602 - 5,131,167 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Car9
42 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	286
Count of miRNA genes:	157
Interacting mature miRNAs:	175
Transcripts:	ENSRNOT00000023060
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331756	Rf34	Renal function QTL 34	4.16275		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	1	90450412	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1331771	Rf35	Renal function QTL 35	4.36965		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	729470	86724018	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
8662454	Vetf3	Vascular elastic tissue fragility QTL 3	27.4		artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	5	2282226	69540447	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
1600358	Mamtr5	Mammary tumor resistance QTL 5			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	18873947	63873947	Rat
1358353	Srcrtb2	Stress Responsive Cort Basal QTL 2	3.48	0.003	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	18873947	74251464	Rat
8552954	Pigfal14	Plasma insulin-like growth factor 1 level QTL 14	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	21226744	66226744	Rat
1578767	Stresp17	Stress response QTL 17	4.3	0.01	blood aldosterone amount (VT:0005346)	plasma aldosterone level (CMO:0000551)	5	27955440	72955440	Rat
1578776	Stresp18	Stress response QTL 18	2.9		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	5	27955440	72955440	Rat
6903292	Stl28	Serum triglyceride level QTL 28	2.6	0.0073	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	5	28515489	73515489	Rat
6903306	Scl35	Serum cholesterol QTL 35	2.6	0.0073	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	28515489	73515489	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1598807	Glom12	Glomerulus QTL 12	2.7		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	5	33215665	78215665	Rat
1298067	Scl15	Serum cholesterol level QTL 15	4.8	0.001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	33215665	78215665	Rat
1302786	Kidm8	Kidney mass QTL 8	28.15		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	33215665	78215665	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641922	Alcrsp8	Alcohol response QTL 8			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	5	35189153	68564008	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331773	Scl26	Serum cholesterol level QTL 26	3.065		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	43726656	86724018	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1300115	Hrtrt7	Heart rate QTL 7	2.76		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	5	47869062	90099692	Rat
9589025	Epfw7	Epididymal fat weight QTL 7	20.66	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	5	49463600	94463600	Rat
7411561	Bw134	Body weight QTL 134	24	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	49463600	94463600	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat

Markers in Region

BE110956

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	57,767,613 - 57,767,802 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	59,013,311 - 59,013,499	NCBI	Rnor6.0
Rnor_5.0	5	63,537,905 - 63,538,093	UniSTS	Rnor5.0
RGSC_v3.4	5	59,990,791 - 59,990,979	UniSTS	RGSC3.4
Celera	5	56,348,192 - 56,348,380	UniSTS
RH 3.4 Map	5	378.7	UniSTS
Cytogenetic Map	5	q22	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3										2
Low		35	47	31	19	31	8	11	62	28	34	11	8
Below cutoff		8	10	10		10			12	5	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001107956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008763676	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121204	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF187254	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000023060 ⟹ ENSRNOP00000023060

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	57,763,206 - 57,769,838 (+)	Ensembl
Rnor_6.0 Ensembl	5	59,008,933 - 59,015,528 (+)	Ensembl

RefSeq Acc Id:

NM_001107956 ⟹ NP_001101426

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	62,559,024 - 62,565,626 (+)	NCBI
mRatBN7.2	5	57,763,234 - 57,769,838 (+)	NCBI
Rnor_6.0	5	59,008,933 - 59,015,535 (+)	NCBI
Rnor_5.0	5	63,533,527 - 63,540,129 (+)	NCBI
RGSC_v3.4	5	59,986,413 - 59,993,015 (+)	RGD
Celera	5	56,343,808 - 56,350,416 (+)	RGD

Sequence:

show sequence

GCACGTACAGCCCGTCCACACCGTGTCCTGGGACACCCCAGTCAGCTGCATGGCTTCCCTGGGC
CTGAGCCCCTGGGTCCCTTTGTTGACCCCAGCCCCTACTGTGCAGCTGCTGCTGTTACTGCTGC
TCCTAGTGTCCGCTCATCCCCAGAGCCTGTCCGGGATGCAGGGGGTGCCCTCCTTGGGAGAAAG
TTCATCTGGGGAGGATGATCTGGGCGTGGAGGATCTGCCCAGCGAAGAGGATACACCTGGAGAG
GCGGATCCACCCGGTGGGGAGGATCCACCTGAAGTTAATTCTAAAGCCAGAAAGGAGGATTCCC
TCGCCTTAGAGGACCTACCGACTCCTGAGGCTCCTGAGAACAGGCAAGGTTCCCACAGGGATGA
AAAAGGGGGTGGCCACAGTCTTTGGAGCTATGGAGGCACCCTACTCTGGCCCCAGGTGTCCCCA
GCCTGTGCTGGCCGCTTTCAGTCCCCTGTGGACATTCGTCTGGAGCTCACCTCATTCTGCCGCA
CTCTGCAACCCCTGGAACTACTGGGTTATGAGCTCCAGTCTCTCCCGGAACTGAGCCTGTGCAA
CAATGGCCACACTGTACAGCTGACTCTGCCGCCCGGGCTGAAGATGGTTCTGGGACCTGGGCAG
GAATACCGGGCCCTGCAGTTGCATCTACACTGGGGAACTTCAGATCACCCAGGCTCAGAACACA
CAGTCAATGGCCACCGGTTCCCTGCTGAGATCCATGTGGTTCACCTCAGTACAGCCTTCTCAGA
ACTTCATGAAGCCTTGGGACGCCCAGGAGGCCTGGCGGTTTTGGCTGCCTTTCTGCAGGAGAGT
CCAGAAGAAAACAGTGCCTACGAACAGTTGCTGTCCCACTTGGAAGAAATCGCAGAGGAAGGCT
CCAAGATTGAGATCCCAGGTTTGGATGTATCTGCACTGTTGCCCTCGGACCTCAGTCGCTACTA
CCGATATGAAGGGTCTCTGACCACACCTCCCTGCAGCCAGGGTGTCATCTGGACTGTGTTCAAT
GAGACAGTGAAGCTGAGTGCTAAGCAGCTCCATACGCTCTCCGTTTCCCTGTGGGGACTTCGTG
ATTCTCGACTACAACTGAACTTCCGAGCCACACAACCTTTGAATGGGCGAACGATTGAGGCTTC
CTTCCCTGCTGTAGCGGACAGCAGCCCTGAGCCAGTTCATGTGAATTCCTGCCTCTCTGCTGGT
GACATCCTAGCCTTGGTGTTTGGCCTTCTCTTTGCTGCCACCAGCATCGCCTTCCTCCTACAGC
TGAGGAGGCAGCACAGGCACAGAAGTGGGACCAAAGATGGAGTTACCTACAGCCCTGCGGAAAT
GACAGAAACTGGGGCCTAATGAGGAGAAGCCAGCTAAAGGAGTCTGGGAACCTTTATACAGCGG
CTTCTCCGTAACCACGTAACCACGAAGAACTCATTTCCATCTTTTTTTTTTTTTTCTTTTTTTT
CTGGAGCTGGGGACCGAACCCAGGGCCTCGAGCTTGCTAAGCAAGTGCTCTACCGCTGAGCTAA
ATCCCCAACCCCTCATTTCCATCTTTTTAACTTTCTTCCTTTCCTTAAACGATGGCGATAAGAA
CTTAACAGTGAAAACAGCCAAGATTGGACTCAATTCTCACTGGGTTTTGAGGATTTTTTAAGAC
AGAGTTTTTCCGTGTAGCCCTGGCTGTCCTCAAACTCACTCTGTAGCCTAGGCTGGCTTTGAAC
TTGCCTGTGCCTTCTTAGTGCTGGGATAGAGGGTATCTACCACTACCACCACCCCACAACTCTT
GCTCTTACTATGCTCTACCACTGAGGCATACACACCCCTTGATCTTAACTGTGGAGTCAGGCTG
GCCTTGAACTGTGTGTGTCTAGTGGTGGAGTTTGAACCCAGGGTCTTGTTCCTACTAGACAAGT
GCTCTATCACTGACCTAAACTTCCAGTCCCTTCCCTAGAGCCCTATTCTCCTGTCCCAGCCTCT
TGAATGCTGGGATTACGGGCATGCGTCATCATGCCTGGCTCATCCCAATTATTTAAAGAAATAT
ATATATATAAATCTTCCTAATAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001101426	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	ABM64773	(Get FASTA)	NCBI Sequence Viewer
	EDL98746	(Get FASTA)	NCBI Sequence Viewer
	EDL98747	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000023060
	ENSRNOP00000023060.5

RefSeq Acc Id:	NP_001101426 ⟸ NM_001107956
- Peptide Label:	precursor
- UniProtKB:	F7FL00 (UniProtKB/TrEMBL), A6IJ26 (UniProtKB/TrEMBL), A2IBE1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MASLGLSPWVPLLTPAPTVQLLLLLLLLVSAHPQSLSGMQGVPSLGESSSGEDDLGVEDLPSEE DTPGEADPPGGEDPPEVNSKARKEDSLALEDLPTPEAPENRQGSHRDEKGGGHSLWSYGGTLLW PQVSPACAGRFQSPVDIRLELTSFCRTLQPLELLGYELQSLPELSLCNNGHTVQLTLPPGLKMV LGPGQEYRALQLHLHWGTSDHPGSEHTVNGHRFPAEIHVVHLSTAFSELHEALGRPGGLAVLAA FLQESPEENSAYEQLLSHLEEIAEEGSKIEIPGLDVSALLPSDLSRYYRYEGSLTTPPCSQGVI WTVFNETVKLSAKQLHTLSVSLWGLRDSRLQLNFRATQPLNGRTIEASFPAVADSSPEPVHVNS CLSAGDILALVFGLLFAATSIAFLLQLRRQHRHRSGTKDGVTYSPAEMTETGA hide sequence

RefSeq Acc Id:

ENSRNOP00000023060 ⟸ ENSRNOT00000023060

Protein Domains

Alpha-carbonic anhydrase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F7FL00-F1-model_v2	AlphaFold	F7FL00	1-437	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693676

Promoter ID:

EPDNEW_R4201

Type:

multiple initiation site

Name:

Car9_1

Description:

carbonic anhydrase 9

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	59,008,950 - 59,009,010	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1306426	AgrOrtholog
BioCyc Gene	G2FUF-41507	BioCyc
Ensembl Genes	ENSRNOG00000017073	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000023060	ENTREZGENE
	ENSRNOT00000023060.6	UniProtKB/TrEMBL
Gene3D-CATH	3.10.200.10	UniProtKB/TrEMBL
InterPro	Carbonic_anhydrase_a	UniProtKB/TrEMBL
	Carbonic_anhydrase_a-class	UniProtKB/TrEMBL
	Carbonic_anhydrase_a-class_CS	UniProtKB/TrEMBL
	Carbonic_anhydrase_a_sf	UniProtKB/TrEMBL
KEGG Report	rno:313495	UniProtKB/TrEMBL
NCBI Gene	313495	ENTREZGENE
PANTHER	PTHR18952	UniProtKB/TrEMBL
	PTHR18952:SF18	UniProtKB/TrEMBL
Pfam	Carb_anhydrase	UniProtKB/TrEMBL
PhenoGen	Car9	PhenoGen
PROSITE	ALPHA_CA_1	UniProtKB/TrEMBL
	ALPHA_CA_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000017073	RatGTEx
SMART	Carb_anhydrase	UniProtKB/TrEMBL
Superfamily-SCOP	Euk_COanhd	UniProtKB/TrEMBL
UniProt	A2IBE1	ENTREZGENE
	A6IJ26	ENTREZGENE, UniProtKB/TrEMBL
	F7FL00	ENTREZGENE, UniProtKB/TrEMBL
UniProt Secondary	A2IBE1	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-04-18	Car9	carbonic anhydrase 9	Ca9	carbonic anhydrase 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2019-04-16	Ca9	carbonic anhydrase 9	Car9	carbonic anhydrase 9	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-04-30	Car9	carbonic anhydrase 9	Car9_predicted	carbonic anhydrase 9 (predicted)	'predicted' is removed	2292626	APPROVED
2005-01-12	Car9_predicted	carbonic anhydrase 9 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)