Advanced Search (OLGA)

Gene: Trim44 (tripartite motif-containing 44) Rattus norvegicus

Analyze

Symbol:

Trim44

Name:

tripartite motif-containing 44

RGD ID:

1304877

Description:

Predicted to enable ubiquitin protein ligase activity. Involved in response to angiotensin. Located in cytoplasm. Human ortholog(s) of this gene implicated in aniridia. Orthologous to human TRIM44 (tripartite motif containing 44); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; acetamide.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

DIPB protein; LOC362172; tripartite motif protein 44; tripartite motif-containing protein 44

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TRIM44 (tripartite motif containing 44)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Trim44 (tripartite motif-containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Trim44 (tripartite motif containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TRIM44 (tripartite motif containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TRIM44 (tripartite motif containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Trim44 (tripartite motif containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TRIM44 (tripartite motif containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TRIM44 (tripartite motif containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Trim44 (tripartite motif containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Trim44 (tripartite motif containing 44)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	PRRC1 (proline rich coiled-coil 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	TRIM44 (tripartite motif containing 44)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Trim44 (tripartite motif-containing 44)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Trim44 (tripartite motif-containing 44)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	trim44 (tripartite motif containing 44)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	trim44 (tripartite motif containing 44)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y47G6A.14	Alliance	DIOPT (Ensembl Compara\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	trim44	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	trim44	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	109,048,643 - 109,183,821 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	109,048,643 - 109,183,821 (-)	Ensembl				GRCr8
mRatBN7.2	3	88,593,619 - 88,729,085 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	88,592,719 - 88,729,188 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	92,174,688 - 92,232,227 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	100,773,706 - 100,831,243 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	98,593,249 - 98,650,810 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	91,968,781 - 92,242,138 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	92,183,556 - 92,242,318 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	98,626,537 - 98,894,480 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	87,458,183 - 87,594,329 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	87,703,331 - 87,822,337 (-)	NCBI		Celera
RGSC_v3.1	3	87,354,610 - 87,490,757 (-)	NCBI
Cytogenetic Map	3	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

aniridia (ISO)

Aniridia 3 (ISO)

Cardiomegaly (IEP,IMP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,4-methylenedioxymethamphetamine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

amphetamine (EXP)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

bafilomycin A1 (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[e]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

butanal (ISO)

chloroquine (ISO)

cisplatin (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

doxorubicin (ISO)

ethanol (ISO)

flutamide (EXP)

folic acid (ISO)

hydrogen peroxide (ISO)

methapyrilene (ISO)

N-acetyl-L-cysteine (ISO)

nitrates (ISO)

paracetamol (EXP,ISO)

perfluorohexanesulfonic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

potassium chromate (ISO)

sodium arsenite (ISO)

succimer (ISO)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

tungsten (ISO)

valproic acid (EXP,ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

innate immune response (IBA)

negative regulation of protein K48-linked ubiquitination (ISO)

positive regulation of cytokine-mediated signaling pathway (ISO)

positive regulation of defense response to virus by host (ISO)

positive regulation of DNA-templated transcription (ISO)

positive regulation of non-canonical NF-kappaB signal transduction (ISO)

protein stabilization (IBA,ISO)

regulation of gene expression (IBA,ISO)

response to angiotensin (IEP)

Cellular Component

cytoplasm (IBA,IDA)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

ubiquitin protein ligase activity (IBA)

zinc ion binding (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Cardiac-specific Trim44 knockout in rat attenuates isoproterenol-induced cardiac remodeling via inhibition of AKT/mTOR pathway.	Jiang XY, etal., Dis Model Mech. 2023 May 1;16(5):dmm049444. doi: 10.1242/dmm.049444. Epub 2022 Aug 18.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:23460740	PMID:26394807	PMID:35609523

Genomics

Comparative Map Data

Trim44
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	109,048,643 - 109,183,821 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	3	109,048,643 - 109,183,821 (-)	Ensembl				GRCr8
mRatBN7.2	3	88,593,619 - 88,729,085 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	88,592,719 - 88,729,188 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	3	92,174,688 - 92,232,227 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	100,773,706 - 100,831,243 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	98,593,249 - 98,650,810 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	91,968,781 - 92,242,138 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	92,183,556 - 92,242,318 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	3	98,626,537 - 98,894,480 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	3	87,458,183 - 87,594,329 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	3	87,703,331 - 87,822,337 (-)	NCBI		Celera
RGSC_v3.1	3	87,354,610 - 87,490,757 (-)	NCBI
Cytogenetic Map	3	q32	NCBI

TRIM44
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	35,662,775 - 35,818,007 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	35,662,537 - 35,818,007 (+)	Ensembl			hg38	GRCh38
GRCh37	11	35,684,323 - 35,839,557 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	35,640,929 - 35,786,351 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	11	35,640,928 - 35,786,333	NCBI
Celera	11	35,831,618 - 35,978,179 (+)	NCBI		Celera
Cytogenetic Map	11	p13	NCBI
HuRef	11	35,382,982 - 35,529,605 (+)	NCBI		HuRef
CHM1_1	11	35,682,770 - 35,829,354 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	35,801,539 - 35,956,748 (+)	NCBI		T2T-CHM13v2.0

Trim44
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	102,130,464 - 102,231,541 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	102,130,464 - 102,238,173 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	2	102,300,119 - 102,400,900 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	102,300,119 - 102,407,828 (-)	Ensembl			mm10	GRCm38
MGSCv37	2	102,140,276 - 102,241,057 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	2	102,100,958 - 102,201,739 (-)	NCBI		MGSCv36	mm8
Celera	2	103,537,119 - 103,637,729 (-)	NCBI		Celera
Cytogenetic Map	2	E2	NCBI
cM Map	2	54.13	NCBI

Trim44
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	10,580,002 - 10,690,349 (-)	Ensembl
ChiLan1.0	NW_004955422	10,580,002 - 10,690,349 (-)	NCBI	ChiLan1.0	ChiLan1.0

TRIM44
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	37,881,633 - 38,111,341 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	37,886,297 - 38,116,016 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	35,633,985 - 35,782,260 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	35,508,589 - 35,656,684 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	35,508,083 - 35,656,684 (+)	Ensembl			panPan2	panpan1.1

TRIM44
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	32,242,830 - 32,351,540 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	18	32,247,146 - 32,351,648 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	31,849,489 - 31,958,122 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	32,853,137 - 32,961,804 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	32,853,874 - 32,962,301 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	32,414,167 - 32,522,742 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	31,999,405 - 32,108,058 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	32,644,829 - 32,753,492 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Trim44
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	29,315,842 - 29,424,036 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936533	2,437,641 - 2,548,837 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936533	2,440,241 - 2,548,831 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TRIM44
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	25,276,859 - 25,378,448 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	25,275,193 - 25,378,738 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	27,638,106 - 27,737,932 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TRIM44
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	29,461,928 - 29,592,084 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	29,464,090 - 29,592,270 (-)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666038	126,584,251 - 126,719,217 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Trim44
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	11,378,172 - 11,550,337 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624767	11,373,992 - 11,550,622 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Trim44
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	5	80,128,735 - 80,240,136 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Trim44
883 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	49
Count of miRNA genes:	42
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000007018
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	51490129	111359995	Rat
1358293	Bw38	Body weight QTL 38	6	0.0000031	body mass (VT:0001259)	body weight (CMO:0000012)	3	74364268	119364268	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	73592611	110333156	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	96509147	141509147	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	73592512	136118980	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	51581665	184004958	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	67641776	167835660	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	58601291	153936591	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	49872657	138829559	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	73592512	136118980	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	85062224	136118980	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	85062224	136118980	Rat
7387306	Bw124	Body weight QTL 124	3.2	0.0003	body mass (VT:0001259)	body weight (CMO:0000012)	3	104545086	149545086	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	81425008	141509147	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	70845569	136091483	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	3	93829559	138829559	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	101255536	134750886	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	79649560	177741895	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	96509147	141509147	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	70311536	115311536	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	81541464	126563126	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	90755164	141509147	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	36721849	110333156	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	42158111	124558371	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	1	141509147	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	98651826	167012663	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	42158111	124558371	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	5675975	141509147	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	67641995	130815812	Rat

Markers in Region

BE120249

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	88,637,021 - 88,637,172 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	92,007,853 - 92,008,003	NCBI	Rnor6.0
Rnor_5.0	3	98,665,299 - 98,665,449	UniSTS	Rnor5.0
RGSC_v3.4	3	87,497,646 - 87,497,796	UniSTS	RGSC3.4
Celera	3	87,742,175 - 87,742,325	UniSTS
RH 3.4 Map	3	671.6	UniSTS
Cytogenetic Map	3	q31	UniSTS

AI579384

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	88,685,318 - 88,685,438 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	92,198,004 - 92,198,123	NCBI	Rnor6.0
Rnor_5.0	3	98,850,512 - 98,850,631	UniSTS	Rnor5.0
RGSC_v3.4	3	87,550,155 - 87,550,274	UniSTS	RGSC3.4
Celera	3	87,779,445 - 87,779,564	UniSTS
RH 3.4 Map	3	670.2	UniSTS
Cytogenetic Map	3	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001013203	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY551091	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007018 ⟹ ENSRNOP00000007018

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	109,048,643 - 109,183,821 (-)	Ensembl
mRatBN7.2 Ensembl	3	88,592,719 - 88,729,188 (-)	Ensembl
Rnor_6.0 Ensembl	3	92,183,556 - 92,242,318 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000123330 ⟹ ENSRNOP00000107994

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	3	109,105,195 - 109,183,821 (-)	Ensembl

RefSeq Acc Id:

NM_001013203 ⟹ NP_001013221

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	109,048,643 - 109,183,821 (-)	NCBI
mRatBN7.2	3	88,593,619 - 88,728,820 (-)	NCBI
Rnor_6.0	3	91,968,781 - 92,242,138 (-)	NCBI
Rnor_5.0	3	98,626,537 - 98,894,480 (-)	NCBI
RGSC_v3.4	3	87,458,183 - 87,594,329 (-)	RGD
Celera	3	87,703,331 - 87,822,337 (-)	RGD

Sequence:

show sequence

ATGGCCTCCGGAGTGGGCGCGGCCTGCGAGGAGCTGCCTCCCGACGGCACGTGTGACGAGTGTG
AACCCGACGAGGCGCCCGGGGCGGAGGAGGTGTGCCGCGATTGCGGCTTCTGCTACTGCCGCCG
CCACGCTGACGCGCACCGCCAGAAGTTCCTCAGCCACCGCCTGGCCGCGTACGTCCATGGCGCC
CAGGCCTGGACTCCGCCAGCCAGCGGGGACGACGCGCTCCCCGAAGACGTCGAGGCCAAAGGGG
AGGCCGAGGGGGAGGTAGAGAGCGAGGTCGGGGAAGAAGAGAGCGAGTCGGAGGTAGACAGTGA
GTCGGAAGAAGAGAGCGAGACAGAGGAAGACAGTGAGGATGAGAGTGATGAGGAGAGTGAAGAA
GACAGCGAGGAAGAGATGGAAGATGAGCAGGAAAGTGAGGCGGAGGAAGACAACCAAGAAGGAG
AATCTGAGGCAGAAGGGGAAACTGAGGCAGAAAGCGAATTTGACCCCGAAATAGAGATGGAAGC
GGAGAGAGTGGCCAAGAGGAAGTGTCCAGACCATGGGCTGGATTTGAGCACCTATTGCCAGGAA
GATAGGCAGCTTATCTGTGTCCTGTGTCCAGTCATTGGGGCTCACCGGGGCCACCAGCTGTCCA
CGTTAGATGAAGCCTTCGAAGAGCTGAGAAGCAAAGATTCTGGTGGACTGAAGGCAGCTATGAT
AGAGTTGGTGGAAAGGTTAAAGTTCAAGAGCTCAGATCCTAAAGTAACTCGAGACCAAATGAAA
GTATTTATACAGCAAGAATTTAAGAAAGTTCAGAAAGTGATTGCTGATGAGGAGCAGAAGGCTC
TTCATTTAGTGGACATCCAAGAAGCAATGGCCACGGCTCATGTGACTGAGATATTGGCGGACAT
CCAATCTCACATGGATAGGTTGATGACTCAGATGGCCCAGGCCAAGGAACAACTTGATACCTCT
AATGAATCAGCTGAGCCAAAGGCAGAGGGTGATGAGGAAGGACCCAGTGGTGCCAGTGAAGAAG
AGGACACATGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001013221	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAS58454	(Get FASTA)	NCBI Sequence Viewer
	EDL79639	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007018
	ENSRNOP00000007018.8
GenBank Protein	Q6QA27	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001013221 ⟸ NM_001013203

- UniProtKB:

Q6QA27 (UniProtKB/Swiss-Prot), A6HNN8 (UniProtKB/TrEMBL), R9PXS7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASGVGAACEELPPDGTCDECEPDEAPGAEEVCRDCGFCYCRRHADAHRQKFLSHRLAAYVHGA
QAWTPPASGDDALPEDVEAKGEAEGEVESEVGEEESESEVDSESEEESETEEDSEDESDEESEE
DSEEEMEDEQESEAEEDNQEGESEAEGETEAESEFDPEIEMEAERVAKRKCPDHGLDLSTYCQE
DRQLICVLCPVIGAHRGHQLSTLDEAFEELRSKDSGGLKAAMIELVERLKFKSSDPKVTRDQMK
VFIQQEFKKVQKVIADEEQKALHLVDIQEAMATAHVTEILADIQSHMDRLMTQMAQAKEQLDTS
NESAEPKAEGDEEGPSGASEEEDT

hide sequence

Ensembl Acc Id:

ENSRNOP00000007018 ⟸ ENSRNOT00000007018

Ensembl Acc Id:

ENSRNOP00000107994 ⟸ ENSRNOT00000123330

Protein Domains

B box-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6QA27-F1-model_v2	AlphaFold	Q6QA27	1-344	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692246

Promoter ID:

EPDNEW_R2771

Type:

initiation region

Name:

Trim44_1

Description:

tripartite motif-containing 44

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	92,242,321 - 92,242,381	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1304877	AgrOrtholog
BioCyc Gene	G2FUF-48604	BioCyc
Ensembl Genes	ENSRNOG00000005191	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000007018	ENTREZGENE
	ENSRNOT00000007018.8	UniProtKB/Swiss-Prot
Gene3D-CATH	4.10.830.40	UniProtKB/Swiss-Prot
	Classic Zinc Finger	UniProtKB/Swiss-Prot
InterPro	TRIM/RBCC	UniProtKB/Swiss-Prot
	Znf_B-box	UniProtKB/Swiss-Prot
KEGG Report	rno:362172	UniProtKB/Swiss-Prot
NCBI Gene	362172	ENTREZGENE
PANTHER	E3 UBIQUITIN-PROTEIN LIGASE TRIM	UniProtKB/Swiss-Prot
Pfam	zf-B_box	UniProtKB/Swiss-Prot
PhenoGen	Trim44	PhenoGen
PROSITE	ZF_BBOX	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000005191	RatGTEx
SMART	BBOX	UniProtKB/Swiss-Prot
Superfamily-SCOP	B-box zinc-binding domain	UniProtKB/Swiss-Prot
UniProt	A0ABK0LQ64_RAT	UniProtKB/TrEMBL
	A6HNN8	ENTREZGENE, UniProtKB/TrEMBL
	Q6QA27	ENTREZGENE
	R9PXS7	ENTREZGENE, UniProtKB/TrEMBL
	TRI44_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-03-07	Trim44	tripartite motif-containing 44	Trim44	tripartite motif protein 44	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Trim44	tripartite motif protein 44		tripartite motif-containing 44	Name updated	1299863	APPROVED
2005-12-06	Trim44	tripartite motif-containing 44	Trim44_predicted	tripartite motif-containing 44 (predicted)	Symbol and Name updated	1559027	APPROVED
2005-01-12	Trim44_predicted	tripartite motif-containing 44 (predicted)			Symbol and Name status set to approved	70820	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM