Symbol:
Pi16
Name:
peptidase inhibitor 16
RGD ID:
1304760
Description:
Predicted to act upstream of or within negative regulation of cell growth involved in cardiac muscle cell development. Predicted to be active in extracellular space. Orthologous to human PI16 (peptidase inhibitor 16); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 3,7-dihydropurine-6-thione; 6-propyl-2-thiouracil.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
LOC294312; protease inhibitor 16
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
PI16 (peptidase inhibitor 16) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Pi16 (peptidase inhibitor 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Pi16 (peptidase inhibitor 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
PI16 (peptidase inhibitor 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
PI16 (peptidase inhibitor 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Pi16 (peptidase inhibitor 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
PI16 (peptidase inhibitor 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
PI16 (peptidase inhibitor 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Pi16 (peptidase inhibitor 16) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
PI16 (peptidase inhibitor 16)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Pi16 (peptidase inhibitor 16)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-2
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-1
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-19
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-11
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-12
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-13
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-14
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-17
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-3
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-5
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-7
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-9
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-15
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-18
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-10
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-20
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-6
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
scl-8
Alliance
DIOPT (OrthoInspector|PANTHER|SonicParanoid)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 7,377,739 - 7,387,003 (+) NCBI GRCr8 mRatBN7.2 20 7,376,073 - 7,385,386 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 7,376,126 - 7,385,383 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 8,087,310 - 8,096,355 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 7,449,169 - 7,458,214 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 7,921,124 - 7,930,158 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 6,923,176 - 6,932,786 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 6,923,489 - 6,932,786 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 9,149,348 - 9,172,502 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 7,636,282 - 7,645,221 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 7,633,303 - 7,644,577 (+) NCBI Celera 20 8,922,747 - 8,930,944 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Pi16 Rat 17beta-estradiol decreases expression ISO Pi16 (Mus musculus) 6480464 Estradiol results in decreased expression of PI16 mRNA CTD PMID:19484750 Pi16 Rat 2,2',5,5'-tetrachlorobiphenyl increases expression ISO PI16 (Homo sapiens) 6480464 2 more ... CTD PMID:36804509 Pi16 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of PI16 mRNA CTD PMID:34747641 Pi16 Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Pi16 (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Pi16 Rat 3,4-methylenedioxymethamphetamine decreases expression ISO Pi16 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased expression of PI16 mRNA CTD PMID:20188158 Pi16 Rat 3,4-methylenedioxymethamphetamine decreases methylation ISO Pi16 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in decreased methylation of PI16 promoter CTD PMID:26251327 Pi16 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Pi16 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of PI16 mRNA CTD PMID:26251327 Pi16 Rat 3,7-dihydropurine-6-thione increases expression EXP 6480464 Mercaptopurine results in increased expression of PI16 mRNA CTD PMID:23358152 Pi16 Rat 4,4'-sulfonyldiphenol increases expression ISO Pi16 (Mus musculus) 6480464 bisphenol S results in increased expression of PI16 mRNA CTD PMID:30951980 Pi16 Rat 4-hydroxyphenyl retinamide decreases expression ISO Pi16 (Mus musculus) 6480464 Fenretinide results in decreased expression of PI16 mRNA CTD PMID:28973697 Pi16 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of PI16 mRNA CTD PMID:24780913 Pi16 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of PI16 mRNA CTD PMID:31881176 Pi16 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of PI16 mRNA CTD PMID:28959563 Pi16 Rat aldehydo-D-glucose multiple interactions ISO Pi16 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of PI16 mRNA CTD PMID:37567420 Pi16 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of PI16 mRNA CTD PMID:30779732 Pi16 Rat benzo[a]pyrene decreases expression ISO Pi16 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of PI16 mRNA CTD PMID:22610609 Pi16 Rat benzo[a]pyrene increases expression ISO Pi16 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of PI16 mRNA CTD PMID:32417428 Pi16 Rat bis(2-ethylhexyl) phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of PI16 promoter CTD PMID:23359474 Pi16 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of PI16 promoter CTD PMID:23359474 Pi16 Rat bisphenol A increases expression ISO Pi16 (Mus musculus) 6480464 bisphenol A results in increased expression of PI16 mRNA CTD PMID:32156529 Pi16 Rat bisphenol A multiple interactions ISO PI16 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PI16 gene CTD PMID:31601247 Pi16 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of PI16 mRNA CTD PMID:25181051 Pi16 Rat buta-1,3-diene decreases expression ISO Pi16 (Mus musculus) 6480464 1 and 3-butadiene results in decreased expression of PI16 mRNA CTD PMID:29038090 Pi16 Rat cantharidin decreases expression ISO Pi16 (Mus musculus) 6480464 Cantharidin results in decreased expression of PI16 mRNA CTD PMID:36907384 Pi16 Rat carbon nanotube decreases expression ISO Pi16 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 and PMID:25620056 Pi16 Rat carbon nanotube increases expression ISO Pi16 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of PI16 mRNA CTD PMID:25620056 Pi16 Rat CGP 52608 multiple interactions ISO PI16 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to PI16 gene] CTD PMID:28238834 Pi16 Rat chromium atom multiple interactions ISO Pi16 (Mus musculus) 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in increased expression of PI16 mRNA] CTD PMID:16940432 Pi16 Rat copper atom decreases expression EXP 6480464 Copper results in decreased expression of PI16 mRNA CTD PMID:30556269 Pi16 Rat copper(0) decreases expression EXP 6480464 Copper results in decreased expression of PI16 mRNA CTD PMID:30556269 Pi16 Rat D-glucose multiple interactions ISO Pi16 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of PI16 mRNA CTD PMID:37567420 Pi16 Rat dexamethasone decreases expression ISO Pi16 (Mus musculus) 6480464 Dexamethasone results in decreased expression of PI16 mRNA CTD PMID:22733784 Pi16 Rat dibutyl phthalate multiple interactions EXP 6480464 [bisphenol A co-treated with Diethylhexyl Phthalate co-treated with Dibutyl Phthalate] affects the methylation of PI16 promoter CTD PMID:23359474 Pi16 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in decreased expression of PI16 mRNA CTD PMID:33729688 Pi16 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of PI16 mRNA CTD PMID:25152437 Pi16 Rat doxorubicin decreases expression ISO PI16 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of PI16 mRNA CTD PMID:29803840 Pi16 Rat fructose multiple interactions ISO Pi16 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of PI16 mRNA CTD PMID:37567420 Pi16 Rat fulvestrant multiple interactions ISO PI16 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in increased methylation of PI16 gene CTD PMID:31601247 Pi16 Rat furan increases expression EXP 6480464 furan results in increased expression of PI16 mRNA CTD PMID:27387713 Pi16 Rat genistein decreases expression ISO Pi16 (Mus musculus) 6480464 Genistein results in decreased expression of PI16 mRNA CTD PMID:32186404 Pi16 Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of PI16 mRNA CTD PMID:22061828 and PMID:33387578 Pi16 Rat glucose multiple interactions ISO Pi16 (Mus musculus) 6480464 [lard co-treated with Cholesterol and Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose] results in increased expression of PI16 mRNA CTD PMID:37567420 Pi16 Rat lead diacetate multiple interactions ISO Pi16 (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of PI16 5' UTR more ... CTD PMID:33445541 Pi16 Rat lead(0) multiple interactions ISO Pi16 (Mus musculus) 6480464 [lead acetate results in increased abundance of Lead] which results in increased methylation of PI16 5' UTR more ... CTD PMID:33445541 Pi16 Rat lipopolysaccharide multiple interactions ISO PI16 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pi16 Rat mercaptopurine increases expression EXP 6480464 Mercaptopurine results in increased expression of PI16 mRNA CTD PMID:23358152 Pi16 Rat monosodium L-glutamate decreases expression ISO Pi16 (Mus musculus) 6480464 Sodium Glutamate results in decreased expression of PI16 mRNA CTD PMID:22078008 Pi16 Rat nicotinic acid multiple interactions ISO Pi16 (Mus musculus) 6480464 LEPR gene mutant form promotes the reaction [[Niacin binds to Chromium] which results in increased expression of PI16 mRNA] CTD PMID:16940432 Pi16 Rat paracetamol decreases expression ISO PI16 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of PI16 mRNA CTD PMID:22230336 Pi16 Rat pirinixic acid increases expression ISO Pi16 (Mus musculus) 6480464 pirinixic acid results in increased expression of PI16 mRNA CTD PMID:20813756 Pi16 Rat propanal increases expression ISO PI16 (Homo sapiens) 6480464 propionaldehyde results in increased expression of PI16 mRNA CTD PMID:26079696 Pi16 Rat purine-6-thiol increases expression EXP 6480464 Mercaptopurine results in increased expression of PI16 mRNA CTD PMID:23358152 Pi16 Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO PI16 (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of PI16 mRNA CTD PMID:35811015 Pi16 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO PI16 (Homo sapiens) 6480464 [S-(1 more ... CTD PMID:35811015 Pi16 Rat silicon dioxide decreases expression ISO PI16 (Homo sapiens) 6480464 Silicon Dioxide analog results in decreased expression of PI16 mRNA CTD PMID:23806026 Pi16 Rat sodium arsenite increases expression ISO Pi16 (Mus musculus) 6480464 sodium arsenite results in increased expression of PI16 mRNA CTD PMID:37682722 Pi16 Rat Soman increases expression EXP 6480464 Soman results in increased expression of PI16 mRNA CTD PMID:19281266 Pi16 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of PI16 mRNA CTD PMID:34492290 Pi16 Rat titanium dioxide decreases expression ISO Pi16 (Mus musculus) 6480464 titanium dioxide results in decreased expression of PI16 mRNA CTD PMID:23557971 Pi16 Rat titanium dioxide decreases methylation ISO Pi16 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of PI16 gene CTD PMID:35295148 Pi16 Rat troglitazone increases expression ISO Pi16 (Mus musculus) 6480464 troglitazone results in increased expression of PI16 mRNA CTD PMID:28973697 Pi16 Rat trovafloxacin decreases expression ISO Pi16 (Mus musculus) 6480464 trovafloxacin results in decreased expression of PI16 mRNA CTD PMID:35537566
17beta-estradiol (ISO) 2,2',5,5'-tetrachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3,7-dihydropurine-6-thione (EXP) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) acrylamide (EXP) aldehydo-D-glucose (ISO) amphetamine (EXP) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (EXP) bisphenol A (EXP,ISO) buta-1,3-diene (ISO) cantharidin (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chromium atom (ISO) copper atom (EXP) copper(0) (EXP) D-glucose (ISO) dexamethasone (ISO) dibutyl phthalate (EXP) dioxygen (EXP) diuron (EXP) doxorubicin (ISO) fructose (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) gentamycin (EXP) glucose (ISO) lead diacetate (ISO) lead(0) (ISO) lipopolysaccharide (ISO) mercaptopurine (EXP) monosodium L-glutamate (ISO) nicotinic acid (ISO) paracetamol (ISO) pirinixic acid (ISO) propanal (ISO) purine-6-thiol (EXP) S-(1,2-dichlorovinyl)-L-cysteine (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) thioacetamide (EXP) titanium dioxide (ISO) troglitazone (ISO) trovafloxacin (ISO)
Pi16 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 7,377,739 - 7,387,003 (+) NCBI GRCr8 mRatBN7.2 20 7,376,073 - 7,385,386 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 7,376,126 - 7,385,383 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 8,087,310 - 8,096,355 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 7,449,169 - 7,458,214 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 7,921,124 - 7,930,158 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 6,923,176 - 6,932,786 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 6,923,489 - 6,932,786 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 9,149,348 - 9,172,502 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 7,636,282 - 7,645,221 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 7,633,303 - 7,644,577 (+) NCBI Celera 20 8,922,747 - 8,930,944 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
PI16 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 36,948,296 - 36,964,837 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 36,948,263 - 36,964,837 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 36,916,072 - 36,932,613 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 37,030,187 - 37,040,591 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 37,030,186 - 37,040,585 NCBI Celera 6 38,477,186 - 38,487,588 (+) NCBI Celera Cytogenetic Map 6 p21.2 NCBI HuRef 6 36,634,272 - 36,650,950 (+) NCBI HuRef CHM1_1 6 36,917,863 - 36,934,414 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 36,771,401 - 36,787,902 (+) NCBI T2T-CHM13v2.0
Pi16 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 29,537,770 - 29,547,876 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 29,536,654 - 29,549,567 (+) Ensembl GRCm39 Ensembl GRCm38 17 29,318,796 - 29,328,903 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 29,317,680 - 29,330,593 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 29,455,827 - 29,465,847 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 29,046,245 - 29,056,425 (+) NCBI MGSCv36 mm8 Celera 17 29,861,061 - 29,871,118 (+) NCBI Celera Cytogenetic Map 17 A3.3 NCBI cM Map 17 15.22 NCBI
Pi16 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 6,067,376 - 6,075,262 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 6,066,685 - 6,075,077 (-) NCBI ChiLan1.0 ChiLan1.0
PI16 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 51,417,092 - 51,433,608 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 47,286,841 - 47,303,383 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 36,509,410 - 36,526,692 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 37,711,423 - 37,721,812 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 37,711,423 - 37,721,812 (+) Ensembl panpan1.1 panPan2
PI16 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 6,017,312 - 6,027,048 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 6,017,522 - 6,026,307 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 6,035,851 - 6,045,625 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 6,366,107 - 6,375,879 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 6,366,084 - 6,375,879 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 6,020,811 - 6,030,569 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 6,100,237 - 6,110,017 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 6,198,636 - 6,208,410 (+) NCBI UU_Cfam_GSD_1.0
Pi16 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 41,455,305 - 41,487,837 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 22,475,818 - 22,485,355 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 22,472,505 - 22,485,593 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
PI16 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 32,600,770 - 32,614,924 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 32,600,952 - 32,613,505 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 37,504,371 - 37,516,933 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
PI16 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 35,177,705 - 35,188,314 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 35,178,590 - 35,187,816 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 36,891,942 - 36,902,585 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Pi16
.
Predicted Target Of
Count of predictions: 265 Count of miRNA genes: 162 Interacting mature miRNAs: 178 Transcripts: ENSRNOT00000000632 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 1558640 Prcs2 Prostate cancer susceptibility QTL 2 3.3 prostate integrity trait (VT:0010571) percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943) 20 4606607 17617956 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 4889857 Pur27 Proteinuria QTL 27 12.2 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 20 4606607 17617956 Rat 70154 Insul2 Insulin level QTL 2 3.75 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 6691706 17489458 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat
RH137188
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 7,385,144 - 7,385,364 (+) MAPPER mRatBN7.2 Rnor_6.0 20 6,932,545 - 6,932,764 NCBI Rnor6.0 Rnor_5.0 20 9,172,261 - 9,172,480 UniSTS Rnor5.0 RGSC_v3.4 20 7,644,980 - 7,645,199 UniSTS RGSC3.4 Celera 20 8,930,703 - 8,930,922 UniSTS RH 3.4 Map 20 94.4 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000000632 ⟹ ENSRNOP00000000632
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 7,376,126 - 7,385,383 (+) Ensembl Rnor_6.0 Ensembl 20 6,923,498 - 6,932,785 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093209 ⟹ ENSRNOP00000076126
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 7,376,126 - 7,385,383 (+) Ensembl Rnor_6.0 Ensembl 20 6,923,498 - 6,932,786 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093373 ⟹ ENSRNOP00000076338
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 6,923,489 - 6,932,786 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000093658
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 6,931,607 - 6,932,786 (+) Ensembl
RefSeq Acc Id:
NM_001170481 ⟹ NP_001163952
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,377,953 - 7,387,003 (+) NCBI mRatBN7.2 20 7,376,336 - 7,385,386 (+) NCBI Rnor_6.0 20 6,923,498 - 6,932,786 (+) NCBI Rnor_5.0 20 9,149,348 - 9,172,502 (+) NCBI RGSC_v3.4 20 7,636,282 - 7,645,221 (+) RGD Celera 20 8,922,747 - 8,930,944 (+) RGD
Sequence:
GAGGGCTGGCCACTATGCACAGCTCCTGCAGCCCGTGGGTGATGCTGCCCCAGCTGCCACTGCTGCTCCTGTTGCTTCTGCTGCTGCTGACTGCCACTGGCCCCGCCACAGCCCTCACAGAGGACGAG
hide sequence
RefSeq Acc Id:
NM_001393815 ⟹ NP_001380744
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,377,953 - 7,387,003 (+) NCBI mRatBN7.2 20 7,376,336 - 7,385,386 (+) NCBI
RefSeq Acc Id:
XM_039098532 ⟹ XP_038954460
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,377,739 - 7,387,003 (+) NCBI mRatBN7.2 20 7,376,104 - 7,385,386 (+) NCBI
RefSeq Acc Id:
XR_362046
Type:
NON-CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 7,377,739 - 7,387,003 (+) NCBI mRatBN7.2 20 7,376,073 - 7,385,386 (+) NCBI Rnor_6.0 20 6,923,176 - 6,932,786 (+) NCBI Rnor_5.0 20 9,149,348 - 9,172,502 (+) NCBI
Sequence:
AGGAACTGTAGGGTGAGCTGGATGCCACAGCACAGTTCTGCTGCTGTTTCTGGGATCTGTCCACCTCAGGAGGGACCATGGAGCTCATATAGCCTTTGGCCTGAGCCCCCATTACTGAGAGAAAAGGA
hide sequence
RefSeq Acc Id:
NP_001163952 ⟸ NM_001170481
- Peptide Label:
isoform 1 precursor
- UniProtKB:
A6JJU6 (UniProtKB/TrEMBL)
- Sequence:
MHSSCSPWVMLPQLPLLLLLLLLLLTATGPATALTEDEKQTMVELHNHYRAQVSPPASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMDVPLAVGNWHEEHEYYNLSTATCDP
hide sequence
Ensembl Acc Id:
ENSRNOP00000000632 ⟸ ENSRNOT00000000632
Ensembl Acc Id:
ENSRNOP00000076338 ⟸ ENSRNOT00000093373
Ensembl Acc Id:
ENSRNOP00000076126 ⟸ ENSRNOT00000093209
RefSeq Acc Id:
XP_038954460 ⟸ XM_039098532
- Peptide Label:
isoform X1
RefSeq Acc Id:
NP_001380744 ⟸ NM_001393815
- Peptide Label:
isoform 2 precursor
RGD ID: 13701453 Promoter ID: EPDNEW_R11968 Type: single initiation site Name: Pi16_1 Description: peptidase inhibitor 16 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 6,923,489 - 6,923,549 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-06
Pi16
peptidase inhibitor 16
Pi16_predicted
protease inhibitor 16 (predicted)
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-12
Pi16_predicted
protease inhibitor 16 (predicted)
Symbol and Name status set to approved
70820 APPROVED
