Symbol:
Boc
Name:
BOC cell adhesion associated, oncogene regulated
RGD ID:
1304550
Description:
Predicted to be involved in axon guidance; cell-cell adhesion; and positive regulation of myoblast differentiation. Predicted to act upstream of or within cell projection organization and smoothened signaling pathway. Located in axonal growth cone. Orthologous to human BOC (BOC cell adhesion associated, oncogene regulated); PARTICIPATES IN altered Hedgehog signaling pathway; Hedgehog signaling pathway; pancreatic cancer pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; acrylamide.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
biregional cell adhesion molecule-related/down-regulated by oncogenes (Cdon) binding protein; brother of CDO; LOC360715
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
BOC (BOC cell adhesion associated, oncogene regulated) RGD
RGD
Mus musculus (house mouse):
Boc (BOC cell adhesion associated, oncogene regulated) RGD
RGD
Chinchilla lanigera (long-tailed chinchilla):
Boc (BOC cell adhesion associated, oncogene regulated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
BOC (BOC cell adhesion associated, oncogene regulated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
BOC (BOC cell adhesion associated, oncogene regulated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Boc (BOC cell adhesion associated, oncogene regulated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
BOC (BOC cell adhesion associated, oncogene regulated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
BOC (BOC cell adhesion associated, oncogene regulated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Boc (BOC cell adhesion associated, oncogene regulated) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Mus musculus (house mouse):
Boc (BOC cell adhesion associated, oncogene regulated)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Homo sapiens (human):
BOC (BOC cell adhesion associated, oncogene regulated)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
boc (BOC cell adhesion associated, oncogene regulated)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Drosophila melanogaster (fruit fly):
boi
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PhylomeDB)
Drosophila melanogaster (fruit fly):
ihog
Alliance
DIOPT (Ensembl Compara|OrthoFinder|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):
boc
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 69,628,703 - 69,704,009 (+) NCBI GRCr8 mRatBN7.2 11 56,122,697 - 56,198,060 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 56,122,750 - 56,198,059 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 64,936,381 - 65,011,688 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 57,598,208 - 57,673,512 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 56,667,454 - 56,742,665 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 61,084,216 - 61,159,220 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 61,083,757 - 61,158,838 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 65,191,723 - 65,266,748 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 57,668,326 - 57,710,373 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 57,725,916 - 57,801,302 (+) NCBI Celera 11 55,682,824 - 55,757,735 (+) NCBI Celera Cytogenetic Map 11 q21 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Boc Rat (1->4)-beta-D-glucan multiple interactions ISO Boc (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BOC mRNA CTD PMID:36331819 Boc Rat 1,2-dimethylhydrazine increases expression ISO Boc (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of BOC mRNA CTD PMID:22206623 Boc Rat 1-naphthyl isothiocyanate increases expression EXP 6480464 1-Naphthylisothiocyanate results in increased expression of BOC mRNA CTD PMID:30723492 Boc Rat 17beta-estradiol increases expression ISO BOC (Homo sapiens) 6480464 Estradiol results in increased expression of BOC mRNA CTD PMID:23019147 Boc Rat 17beta-estradiol multiple interactions ISO BOC (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of BOC mRNA CTD PMID:30165855 Boc Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Boc (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of BOC mRNA CTD PMID:18691609 Boc Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO BOC (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of BOC mRNA CTD PMID:27913140 Boc Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of BOC mRNA CTD PMID:27913140 Boc Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Boc (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of BOC mRNA CTD PMID:27913140 Boc Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Boc (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of BOC mRNA CTD PMID:21570461 Boc Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of BOC mRNA CTD PMID:28959563 Boc Rat aflatoxin B1 decreases methylation ISO BOC (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of BOC exon CTD PMID:30157460 Boc Rat Aflatoxin B2 alpha increases methylation ISO BOC (Homo sapiens) 6480464 aflatoxin B2 results in increased methylation of BOC exon CTD PMID:30157460 Boc Rat all-trans-retinoic acid increases expression ISO Boc (Mus musculus) 6480464 Tretinoin results in increased expression of BOC mRNA CTD PMID:16788091 Boc Rat all-trans-retinoic acid decreases expression ISO BOC (Homo sapiens) 6480464 Tretinoin results in decreased expression of BOC mRNA CTD PMID:21934132 Boc Rat alpha-Zearalanol multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of BOC mRNA CTD PMID:35163327 Boc Rat arsenous acid decreases expression ISO BOC (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of BOC mRNA CTD PMID:26705709 Boc Rat atrazine decreases expression ISO Boc (Mus musculus) 6480464 Atrazine results in decreased expression of BOC mRNA CTD PMID:33463082 Boc Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of BOC gene CTD PMID:35440735 Boc Rat benzo[a]pyrene decreases expression ISO Boc (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of BOC mRNA CTD PMID:20713471 Boc Rat benzo[a]pyrene increases expression ISO BOC (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of BOC mRNA CTD PMID:32234424 Boc Rat benzo[a]pyrene affects methylation ISO BOC (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of BOC 5' UTR and Benzo(a)pyrene affects the methylation of BOC exon CTD PMID:27901495 and PMID:30157460 Boc Rat benzo[a]pyrene decreases methylation ISO BOC (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased methylation of BOC exon and Benzo(a)pyrene results in decreased methylation of BOC promoter CTD PMID:27901495 Boc Rat benzo[a]pyrene multiple interactions ISO Boc (Mus musculus) 6480464 Benzo(a)pyrene promotes the reaction [AHR protein binds to BOC promoter] CTD PMID:19654925 Boc Rat benzo[e]pyrene increases methylation ISO BOC (Homo sapiens) 6480464 benzo(e)pyrene results in increased methylation of BOC exon CTD PMID:30157460 Boc Rat bisphenol A decreases methylation ISO BOC (Homo sapiens) 6480464 bisphenol A results in decreased methylation of BOC gene CTD PMID:31601247 Boc Rat bisphenol A increases expression ISO Boc (Mus musculus) 6480464 bisphenol A results in increased expression of BOC mRNA CTD PMID:32156529 Boc Rat choline multiple interactions ISO Boc (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BOC mRNA CTD PMID:20938992 Boc Rat cisplatin decreases expression ISO BOC (Homo sapiens) 6480464 Cisplatin results in decreased expression of BOC mRNA CTD PMID:27392435 Boc Rat cisplatin multiple interactions ISO BOC (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of BOC mRNA CTD PMID:27392435 Boc Rat copper atom multiple interactions ISO BOC (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of BOC mRNA CTD PMID:31162603 Boc Rat copper(0) multiple interactions ISO BOC (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in decreased expression of BOC mRNA CTD PMID:31162603 Boc Rat copper(II) sulfate increases expression ISO BOC (Homo sapiens) 6480464 Copper Sulfate results in increased expression of BOC mRNA CTD PMID:19549813 Boc Rat crocidolite asbestos decreases expression ISO Boc (Mus musculus) 6480464 Asbestos and Crocidolite results in decreased expression of BOC mRNA CTD PMID:29279043 Boc Rat diarsenic trioxide decreases expression ISO BOC (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of BOC mRNA CTD PMID:26705709 Boc Rat dimethylarsinic acid decreases expression EXP 6480464 Cacodylic Acid results in decreased expression of BOC mRNA CTD PMID:37567419 Boc Rat dorsomorphin multiple interactions ISO BOC (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Boc Rat doxorubicin decreases expression ISO BOC (Homo sapiens) 6480464 Doxorubicin results in decreased expression of BOC mRNA CTD PMID:29803840 Boc Rat ethanol increases expression ISO Boc (Mus musculus) 6480464 Ethanol results in increased expression of BOC mRNA CTD PMID:30319688 Boc Rat folic acid multiple interactions ISO Boc (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BOC mRNA CTD PMID:20938992 Boc Rat folic acid decreases expression ISO Boc (Mus musculus) 6480464 Folic Acid results in decreased expression of BOC mRNA CTD PMID:25629700 Boc Rat fulvestrant decreases methylation ISO BOC (Homo sapiens) 6480464 Fulvestrant results in decreased methylation of BOC gene CTD PMID:31601247 Boc Rat gentamycin decreases expression EXP 6480464 Gentamicins results in decreased expression of BOC mRNA CTD PMID:33387578 Boc Rat L-methionine multiple interactions ISO Boc (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of BOC mRNA CTD PMID:20938992 Boc Rat lipopolysaccharide multiple interactions ISO BOC (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of BOC mRNA CTD PMID:35811015 Boc Rat mercury dibromide decreases expression ISO BOC (Homo sapiens) 6480464 mercuric bromide results in decreased expression of BOC mRNA CTD PMID:26272509 Boc Rat mercury dibromide multiple interactions ISO BOC (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of BOC mRNA CTD PMID:27188386 Boc Rat methapyrilene increases methylation ISO BOC (Homo sapiens) 6480464 Methapyrilene results in increased methylation of BOC exon CTD PMID:30157460 Boc Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of BOC gene CTD PMID:35440735 Boc Rat methylmercury chloride affects expression ISO Boc (Mus musculus) 6480464 methylmercuric chloride affects the expression of BOC mRNA CTD PMID:21613230 Boc Rat methylmercury chloride decreases expression ISO BOC (Homo sapiens) 6480464 methylmercuric chloride results in decreased expression of BOC mRNA CTD PMID:28001369 Boc Rat methylmercury chloride increases expression ISO BOC (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of BOC mRNA CTD PMID:28001369 Boc Rat nickel atom decreases expression ISO BOC (Homo sapiens) 6480464 Nickel results in decreased expression of BOC mRNA CTD PMID:24768652 Boc Rat ozone multiple interactions ISO Boc (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in decreased expression of BOC mRNA and [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of BOC mRNA CTD PMID:27106289 and PMID:34911549 Boc Rat panobinostat multiple interactions ISO BOC (Homo sapiens) 6480464 [NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of BOC mRNA CTD PMID:27188386 Boc Rat panobinostat increases expression ISO BOC (Homo sapiens) 6480464 panobinostat results in increased expression of BOC mRNA CTD PMID:26272509 Boc Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of BOC mRNA CTD PMID:33387578 Boc Rat perfluorooctane-1-sulfonic acid multiple interactions ISO Boc (Mus musculus) 6480464 [perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of BOC mRNA CTD PMID:36331819 Boc Rat perfluorooctanoic acid multiple interactions EXP 6480464 [Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of BOC mRNA CTD PMID:35163327 Boc Rat phenylmercury acetate multiple interactions ISO BOC (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of BOC mRNA CTD PMID:27188386 Boc Rat potassium dichromate increases expression ISO Boc (Mus musculus) 6480464 Potassium Dichromate results in increased expression of BOC mRNA CTD PMID:23608068 Boc Rat resveratrol multiple interactions ISO BOC (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of BOC mRNA CTD PMID:23557933 Boc Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO BOC (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of BOC mRNA CTD PMID:35811015 Boc Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO BOC (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine co-treated with Lipopolysaccharides] results in decreased expression of BOC mRNA CTD PMID:35811015 Boc Rat SB 431542 multiple interactions ISO BOC (Homo sapiens) 6480464 [NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Boc Rat serpentine asbestos decreases methylation ISO BOC (Homo sapiens) 6480464 Asbestos and Serpentine results in decreased methylation of BOC gene CTD PMID:29523930 Boc Rat sodium arsenite increases expression ISO BOC (Homo sapiens) 6480464 sodium arsenite results in increased expression of BOC mRNA CTD PMID:29301061 Boc Rat sunitinib decreases expression ISO BOC (Homo sapiens) 6480464 Sunitinib results in decreased expression of BOC mRNA CTD PMID:31533062 Boc Rat tetrachloromethane increases expression ISO Boc (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of BOC mRNA CTD PMID:17484886 Boc Rat trichostatin A increases expression ISO BOC (Homo sapiens) 6480464 trichostatin A results in increased expression of BOC mRNA CTD PMID:24935251 Boc Rat triclosan increases expression ISO BOC (Homo sapiens) 6480464 Triclosan results in increased expression of BOC mRNA CTD PMID:30510588 Boc Rat trimellitic anhydride decreases expression ISO Boc (Mus musculus) 6480464 trimellitic anhydride results in decreased expression of BOC mRNA CTD PMID:19042947 Boc Rat valproic acid increases expression ISO BOC (Homo sapiens) 6480464 Valproic Acid results in increased expression of BOC mRNA CTD PMID:24935251 Boc Rat valproic acid decreases expression ISO BOC (Homo sapiens) 6480464 Valproic Acid results in decreased expression of BOC mRNA CTD PMID:23179753 more ... Boc Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of BOC mRNA CTD PMID:19015723
Boc Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 11 69,628,703 - 69,704,009 (+) NCBI GRCr8 mRatBN7.2 11 56,122,697 - 56,198,060 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 11 56,122,750 - 56,198,059 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 11 64,936,381 - 65,011,688 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 11 57,598,208 - 57,673,512 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 11 56,667,454 - 56,742,665 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 11 61,084,216 - 61,159,220 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 11 61,083,757 - 61,158,838 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 11 65,191,723 - 65,266,748 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 11 57,668,326 - 57,710,373 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 11 57,725,916 - 57,801,302 (+) NCBI Celera 11 55,682,824 - 55,757,735 (+) NCBI Celera Cytogenetic Map 11 q21 NCBI
BOC Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 3 113,210,926 - 113,287,459 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 3 113,211,003 - 113,287,459 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 3 112,930,404 - 113,006,306 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 3 114,414,065 - 114,488,996 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 3 111,339,962 - 111,414,896 (+) NCBI Celera Cytogenetic Map 3 q13.2 NCBI HuRef 3 110,306,382 - 110,381,047 (+) NCBI HuRef CHM1_1 3 112,894,972 - 112,969,889 (+) NCBI CHM1_1 T2T-CHM13v2.0 3 115,932,521 - 116,008,527 (+) NCBI T2T-CHM13v2.0
Boc Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 16 44,305,408 - 44,379,233 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 16 44,305,412 - 44,379,260 (-) Ensembl GRCm39 Ensembl GRCm38 16 44,485,045 - 44,558,870 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 16 44,485,049 - 44,558,897 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 16 44,485,158 - 44,558,983 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 16 44,404,377 - 44,478,202 (-) NCBI MGSCv36 mm8 Celera 16 44,843,888 - 44,917,724 (-) NCBI Celera Cytogenetic Map 16 B4 NCBI cM Map 16 28.81 NCBI
Boc Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955427 13,424,478 - 13,493,952 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955427 13,424,478 - 13,492,527 (+) NCBI ChiLan1.0 ChiLan1.0
BOC Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 2 111,206,812 - 111,282,623 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 3 111,211,602 - 111,290,703 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 3 110,354,576 - 110,429,954 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 3 117,277,763 - 117,352,741 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 3 117,277,769 - 117,352,741 (+) Ensembl panpan1.1 panPan2
BOC Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 33 17,508,046 - 17,629,705 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 33 17,556,910 - 17,630,259 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 33 17,611,308 - 17,733,059 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 33 17,752,326 - 17,874,180 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 33 17,801,336 - 17,876,142 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 33 17,556,435 - 17,678,023 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 33 17,604,058 - 17,725,588 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 33 18,153,868 - 18,275,604 (+) NCBI UU_Cfam_GSD_1.0
Boc
BOC Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 13 146,628,134 - 146,703,098 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 13 146,625,218 - 146,703,165 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 13 156,163,631 - 156,182,841 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
BOC Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 22 67,552,105 - 67,635,557 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 22 67,559,150 - 67,635,175 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666041 98,739,855 - 98,920,157 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Boc
.
Predicted Target Of
Count of predictions: 86 Count of miRNA genes: 64 Interacting mature miRNAs: 81 Transcripts: ENSRNOT00000002790 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1300147 Bp187 Blood pressure QTL 187 3.67 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 11 1 69446234 Rat 724554 Iddm17 Insulin dependent diabetes mellitus QTL 17 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 18976208 86241447 Rat 70180 BpQTLcluster10 Blood pressure QTL cluster 10 3.19 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 11 34918041 79918041 Rat 1581565 Pur10 Proteinuria QTL 10 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 4889859 Pur28 Proteinuria QTL 28 19.5 0.001 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 11 45459323 75190161 Rat 8694376 Bw156 Body weight QTL 156 2.25 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 10755497 Bp388 Blood pressure QTL 388 2.76 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 11 19456205 76331918 Rat 10058952 Gmadr6 Adrenal mass QTL 6 2.29 0.0072 adrenal gland mass (VT:0010420) both adrenal glands wet weight to body weight ratio (CMO:0002411) 11 22959403 67959403 Rat 1300130 Rf20 Renal function QTL 20 4.44 kidney glomerulus integrity trait (VT:0010546) kidney glomerulus diameter (CMO:0001166) 11 29528418 60324829 Rat 1558659 Tescar1 Testicular tumor resistance QTL 1 3.9 testis integrity trait (VT:0010572) percentage of study population developing testis tumors during a period of time (CMO:0001261) 11 1041931 66113562 Rat 2298551 Neuinf10 Neuroinflammation QTL 10 3.7 nervous system integrity trait (VT:0010566) spinal cord beta-2 microglobulin mRNA level (CMO:0002125) 11 31239134 78851519 Rat 1300135 Rf19 Renal function QTL 19 3.38 blood creatinine amount (VT:0005328) creatinine clearance (CMO:0000765) 11 40946188 82566702 Rat 2312566 Glom20 Glomerulus QTL 20 3.6 0.001 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 11 44285759 82566702 Rat 724563 Uae10 Urinary albumin excretion QTL 10 6 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 11 27672410 82846715 Rat 9589032 Epfw10 Epididymal fat weight QTL 10 9.29 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 11 23280456 68280456 Rat 724561 Plsm4 Polydactyly-luxate syndrome (PLS) morphotypes QTL 4 0.0003 forelimb integrity trait (VT:0010562) front foot phalanges count (CMO:0001947) 11 54457534 86241447 Rat 9590313 Scort20 Serum corticosterone level QTL 20 6.51 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 11 23280456 68280456 Rat 4889521 Gluco62 Glucose level QTL 62 2.82 0.001 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 11 55136729 82993457 Rat 8694424 Bw162 Body weight QTL 162 3.8 0.001 body lean mass (VT:0010483) lean tissue morphological measurement (CMO:0002184) 11 23280456 68280456 Rat 1581572 Uae35 Urinary albumin excretion QTL 35 0.0001 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 11 44803318 82846466 Rat 1300110 Stl7 Serum triglyceride level QTL 7 4.64 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 11 29528418 82566702 Rat
BE110539
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 11 56,197,818 - 56,197,980 (+) MAPPER mRatBN7.2 Rnor_6.0 11 61,158,979 - 61,159,140 NCBI Rnor6.0 Rnor_5.0 11 65,266,511 - 65,266,672 UniSTS Rnor5.0 RGSC_v3.4 11 57,743,487 - 57,743,648 UniSTS RGSC3.4 Celera 11 55,757,494 - 55,757,655 UniSTS RH 3.4 Map 4 623.62 UniSTS Cytogenetic Map 11 q21 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000002790 ⟹ ENSRNOP00000002790
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 11 56,122,750 - 56,198,059 (+) Ensembl Rnor_6.0 Ensembl 11 61,083,757 - 61,158,838 (+) Ensembl
RefSeq Acc Id:
NM_001108317 ⟹ NP_001101787
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,628,703 - 69,704,009 (+) NCBI mRatBN7.2 11 56,122,750 - 56,198,060 (+) NCBI
RefSeq Acc Id:
XM_017598158 ⟹ XP_017453647
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,628,975 - 69,704,005 (+) NCBI mRatBN7.2 11 56,122,697 - 56,198,056 (+) NCBI Rnor_6.0 11 61,120,139 - 61,159,220 (+) NCBI
Sequence:
CTACTACTACTACTAATAATAATAATAATAATAAGTAAACAAAAGTTCCAACTCTACTTCACATAAAAGTATTGCCGCGTGCCCATGATGGCATGGTGTTTAACCACTGTGTGGTCATTGGAACATTG
hide sequence
RefSeq Acc Id:
XM_017598159 ⟹ XP_017453648
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,628,975 - 69,704,005 (+) NCBI mRatBN7.2 11 56,122,697 - 56,198,056 (+) NCBI Rnor_6.0 11 61,120,139 - 61,159,220 (+) NCBI
Sequence:
CTACTACTACTACTAATAATAATAATAATAATAAGTAAACAAAAGTTCCAACTCTACTTCACAT
hide sequence
RefSeq Acc Id:
XM_017598160 ⟹ XP_017453649
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 11 69,628,975 - 69,704,005 (+) NCBI mRatBN7.2 11 56,122,697 - 56,198,056 (+) NCBI Rnor_6.0 11 61,120,139 - 61,159,220 (+) NCBI
Sequence:
CTACTACTACTACTAATAATAATAATAATAATAAGTAAACAAAAGTTCCAACTCTACTTCACATAAAAGTATTGCCGCGTGCCCATGATGGCATGGTGTTTAACCACTGTGTGGTCATTGGAACATTG
hide sequence
RefSeq Acc Id:
XP_017453647 ⟸ XM_017598158
- Peptide Label:
isoform X1
- Sequence:
MVTCRGEQPMLTLLWFLLAIAGCLADLNEVPQVTVQPMSTVQKLGGTVILGCVVEPPWVNVTWRFNGKELNGSDDALGVLITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLD
hide sequence
RefSeq Acc Id:
XP_017453648 ⟸ XM_017598159
- Peptide Label:
isoform X2
- UniProtKB:
A6IR03 (UniProtKB/TrEMBL)
- Sequence:
MVTCRGEQPMLTLLWFLLAIAGCLADLNEVPQVTVQPMSTVQKLGGTVILGCVVEPPWVNVTWRFNGKELNGSDDALGVLITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLD
hide sequence
RefSeq Acc Id:
XP_017453649 ⟸ XM_017598160
- Peptide Label:
isoform X3
- UniProtKB:
D4A0Z7 (UniProtKB/TrEMBL)
- Sequence:
MVTCRGEQPMLTLLWFLLAIAGCLADLNEVPQVTVQPMSTVQKLGGTVILGCVVEPPWVNVTWRFNGKELNGSDDALGVLITRGTLVIAALNNHTVGRYQCVARMPAGAVASVPATVTLANLQDFKLD
hide sequence
Ensembl Acc Id:
ENSRNOP00000002790 ⟸ ENSRNOT00000002790
RefSeq Acc Id:
NP_001101787 ⟸ NM_001108317
- Peptide Label:
precursor
- UniProtKB:
D4A0Z7 (UniProtKB/TrEMBL)
RGD ID: 13698153 Promoter ID: EPDNEW_R8672 Type: single initiation site Name: Boc_1 Description: BOC cell adhesion associated, oncogene regulated SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 11 61,083,830 - 61,083,890 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2013-03-08
Boc
BOC cell adhesion associated, oncogene regulated
Boc
biregional cell adhesion molecule-related/down-regulated by oncogenes (Cdon) binding protein
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2008-04-30
Boc
biregional cell adhesion molecule-related/down-regulated by oncogenes (Cdon) binding protein
Boc_predicted
biregional cell adhesion molecule-related/down-regulated by oncogenes (Cdon) binding protein (predicted)
'predicted' is removed
2292626 APPROVED
2005-01-12
Boc_predicted
biregional cell adhesion molecule-related/down-regulated by oncogenes (Cdon) binding protein (predicted)
Symbol and Name status set to approved
70820 APPROVED
