Advanced Search (OLGA)

Gene: Ltb (lymphotoxin beta) Rattus norvegicus

Analyze

Symbol:

Ltb

Name:

lymphotoxin beta

RGD ID:

1303162

Description:

Predicted to enable cytokine activity. Predicted to be involved in cell surface receptor signaling pathway; positive regulation of interleukin-12 production; and positive regulation of signal transduction. Predicted to act upstream of or within gene expression; lymph node development; and skin development. Predicted to be located in plasma membrane. Predicted to be active in extracellular space. Orthologous to human LTB (lymphotoxin beta); PARTICIPATES IN cytokine mediated signaling pathway; rheumatoid arthritis pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC103694381; lymphotoxin B; lymphotoxin beta (TNF superfamily, member 3); lymphotoxin-beta; MGC108924

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	LTB (lymphotoxin beta)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther
Mus musculus (house mouse):	Ltb (lymphotoxin B)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ltb (lymphotoxin beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LTB (lymphotoxin beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LTB (lymphotoxin beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ltb (lymphotoxin beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LTB (lymphotoxin beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	LTB (lymphotoxin beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ltb (lymphotoxin beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Ltb (lymphotoxin beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	LTB (lymphotoxin beta)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ltb (lymphotoxin B)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ltb	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ltb	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,632,209 - 3,634,054 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	3,632,210 - 3,634,054 (-)	Ensembl				GRCr8
mRatBN7.2	20	3,627,536 - 3,629,381 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,627,537 - 3,629,381 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	4,327,296 - 4,329,142 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,689,354 - 3,691,200 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,226,971 - 4,228,817 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,184,631 - 5,186,476 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,184,515 - 5,186,503 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,861,335 - 4,863,198 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	6,941,753 - 6,943,598 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	3,666,524 - 3,668,369 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	4,396,109 - 4,397,954 (+)	NCBI		Celera
RGSC_v3.1	20	3,666,751 - 3,668,596 (-)	NCBI
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

contact dermatitis (ISO)

cutaneous leishmaniasis (ISO)

Experimental Liver Cirrhosis (ISO)

visceral leishmaniasis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

1-nitropyrene (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

2-naphthylamine (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3-Nitrofluoranthene (ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-hydroxynon-2-enal (ISO)

5'-S-methyl-5'-thioadenosine (ISO)

6-propyl-2-thiouracil (EXP)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

aripiprazole (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

asperentin (ISO)

benzalkonium chloride (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

Brevianamide A (ISO)

buta-1,3-diene (ISO)

Butylbenzyl phthalate (EXP)

cadmium dichloride (EXP,ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

chloroquine (ISO)

cisplatin (ISO)

clorgyline (ISO)

curcumin (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibenzo[a,l]pyrene (ISO)

Dibutyl phosphate (ISO)

dimethylarsinic acid (ISO)

dioxygen (ISO)

diquat (ISO)

disodium selenite (ISO)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

ethylparaben (ISO)

fentanyl (EXP)

fumonisin B1 (ISO)

furan (EXP)

furosemide (EXP)

gadolinium trichloride (ISO)

glafenine (EXP)

GSK-J4 (ISO)

hydrogen peroxide (ISO)

leflunomide (ISO)

lipopolysaccharide (ISO)

methylarsonic acid (ISO)

Muraglitazar (EXP)

mycophenolic acid (ISO)

mycotoxin (ISO)

N-methyl-N-nitrosourea (ISO)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (EXP)

neoechinulin A (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

nicotine (ISO)

nitrates (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

PF-3758309 (ISO)

progesterone (ISO)

raloxifene (ISO)

S-adenosyl-L-methioninate (ISO)

S-adenosyl-L-methionine (ISO)

sanguinarine (ISO)

SB 431542 (ISO)

silicon dioxide (EXP,ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

succimer (ISO)

testosterone (ISO)

tetrachloromethane (ISO)

theophylline (ISO)

titanium dioxide (EXP,ISO)

TMC-120A (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

vitamin E (ISO)

zaragozic acid A (EXP,ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell surface receptor signaling pathway (IBA)

gene expression (ISO)

immune response (IEA,TAS)

lymph node development (ISO)

positive regulation of canonical NF-kappaB signal transduction (IBA)

positive regulation of cell population proliferation (IEA)

positive regulation of extrinsic apoptotic signaling pathway (IBA)

positive regulation of interleukin-12 production (IEA,ISO)

skin development (ISO)

Cellular Component

extracellular space (IBA,IEA)

membrane (IEA)

plasma membrane (IEA,ISO)

tumor necrosis factor receptor superfamily complex (IEA,ISO)

Molecular Function

cytokine activity (IBA,IEA)

tumor necrosis factor binding (TAS)

tumor necrosis factor receptor binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

cytokine mediated signaling pathway (IEA)

rheumatoid arthritis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	Essential role of lymph nodes in contact hypersensitivity revealed in lymphotoxin-alpha-deficient mice.	Rennert PD, etal., J Exp Med. 2001 Jun 4;193(11):1227-38.
5.	GOA pipeline	RGD automated data pipeline
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Differential activities of secreted lymphotoxin-alpha3 and membrane lymphotoxin-alpha1beta2 in lymphotoxin-induced inflammation: critical role of TNF receptor 1 signaling.	Sacca R, etal., J Immunol 1998 Jan 1;160(1):485-91.
8.	Membrane lymphotoxin contributes to anti-leishmanial immunity by controlling structural integrity of lymphoid organs.	Wilhelm P, etal., Eur J Immunol. 2002 Jul;32(7):1993-2003.
9.	Lymphotoxin alpha beta 2 (membrane lymphotoxin) is critically important for resistance to Leishmania major infection in mice.	Xu G, etal., J Immunol. 2007 Oct 15;179(8):5358-66.

Additional References at PubMed

PMID:12477932	PMID:16246198

Genomics

Comparative Map Data

Ltb
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,632,209 - 3,634,054 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	3,632,210 - 3,634,054 (-)	Ensembl				GRCr8
mRatBN7.2	20	3,627,536 - 3,629,381 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,627,537 - 3,629,381 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	4,327,296 - 4,329,142 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,689,354 - 3,691,200 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,226,971 - 4,228,817 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,184,631 - 5,186,476 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,184,515 - 5,186,503 (+)	Ensembl			rn6	Rnor6.0
Rnor_6.0 Ensembl	20	4,861,335 - 4,863,198 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	6,941,753 - 6,943,598 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	3,666,524 - 3,668,369 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	4,396,109 - 4,397,954 (+)	NCBI		Celera
RGSC_v3.1	20	3,666,751 - 3,668,596 (-)	NCBI
Cytogenetic Map	20	p12	NCBI

LTB
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,580,558 - 31,582,425 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,580,525 - 31,582,522 (-)	Ensembl			hg38	GRCh38
GRCh37	6	31,548,335 - 31,550,202 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,656,314 - 31,658,181 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	31,656,313 - 31,658,181	NCBI
Celera	6	33,146,550 - 33,148,417 (-)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,335,069 - 31,336,936 (-)	NCBI		HuRef
CHM1_1	6	31,550,467 - 31,552,334 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,433,610 - 31,435,477 (-)	NCBI		T2T-CHM13v2.0

Ltb
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,413,483 - 35,415,281 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,413,415 - 35,415,296 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	35,194,507 - 35,196,305 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,194,439 - 35,196,320 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	35,331,452 - 35,333,250 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,802,574 - 34,804,354 (+)	NCBI		MGSCv36	mm8
Celera	17	38,291,216 - 38,293,014 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.59	NCBI

Ltb
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955437	120,966 - 123,973 (-)	NCBI	ChiLan1.0	ChiLan1.0

LTB
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	46,057,500 - 46,060,073 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	42,019,081 - 42,024,574 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	31,241,643 - 31,244,454 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	32,131,607 - 32,133,468 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	32,131,760 - 32,133,467 (-)	Ensembl			panPan2	panpan1.1

LTB
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,079,340 - 1,084,785 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	1,079,358 - 1,081,153 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,215,801 - 1,217,596 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,224,605 - 1,226,400 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	1,224,605 - 1,226,400 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	1,083,338 - 1,085,125 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,151,270 - 1,153,063 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,218,053 - 1,219,848 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Ltb
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	35,628,995 - 35,650,426 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936727	1,910,881 - 1,932,356 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936727	1,929,533 - 1,932,339 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LTB
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	23,704,841 - 23,706,745 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	7	23,704,842 - 23,707,036 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	27,545,187 - 27,547,163 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LTB
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Vero_WHO_p1.0	NW_023666044	31,482,890 - 31,485,770 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ltb
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624754	24,618,888 - 24,620,448 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Ltb
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	18	7,790,964 - 7,792,979 (+)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Ltb
58 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	144
Count of miRNA genes:	113
Interacting mature miRNAs:	127
Transcripts:	ENSRNOT00000001108
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1533200	5306452	Rat
61474	Eae1	Experimental allergic encephalomyelitis QTL 1	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	20	1	6693431	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3626323	10078622	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	6693431	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3626323	9244918	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1	14100378	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Markers in Region

RH127662

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,627,637 - 3,627,847 (+)	MAPPER	mRatBN7.2
mRatBN7.2	20	3,627,637 - 3,627,847 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	5,186,165 - 5,186,374	NCBI	Rnor6.0
Rnor_6.0	20	4,861,455 - 4,861,664	NCBI	Rnor6.0
Rnor_5.0	20	6,941,855 - 6,942,064	UniSTS	Rnor5.0
RGSC_v3.4	20	3,666,626 - 3,666,835	UniSTS	RGSC3.4
Celera	20	4,397,643 - 4,397,852	UniSTS
RH 3.4 Map	20	51.3	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
24	4	31	104	76	79	29	110	29	12	283	178	11	73	51	70	50	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_212507	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088208	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ227971	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231786	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ235217	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000001108 ⟹ ENSRNOP00000001108

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,627,537 - 3,629,381 (-)	Ensembl
Rnor_6.0 Ensembl	20	4,861,353 - 4,863,198 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000079503 ⟹ ENSRNOP00000069775

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	4,861,335 - 4,863,011 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089411 ⟹ ENSRNOP00000072122

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	5,184,515 - 5,186,503 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120807 ⟹ ENSRNOP00000098420

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	3,632,210 - 3,634,054 (-)	Ensembl

RefSeq Acc Id:

NM_212507 ⟹ NP_997672

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,632,209 - 3,634,054 (-)	NCBI
mRatBN7.2	20	3,627,536 - 3,629,381 (-)	NCBI
Rnor_6.0	20	5,184,631 - 5,186,476 (+)	NCBI
Rnor_5.0	20	6,941,753 - 6,943,598 (-)	NCBI
RGSC_v3.4	20	3,666,524 - 3,668,369 (-)	RGD
Celera	20	4,396,109 - 4,397,954 (+)	RGD

Sequence:

show sequence

GGCAGGTGTTTGGGTCTGCAGGGAGGGGTGGCCCTACCCCTGAGGTATGAAAGCCCCTGCCCGG
GTCCTAGCTCTGAGTCTGGATGGGGACACGGGGACTGCAGGGCCTGGGTGGGAGGCCCCAGGGG
AGGGGCTGCCTCTTGCTGGCTGTGGCAGGAGCTACATCGCTGGTGACCCTGCTGTTGGCAGTGC
CTATCACTGTCCTGGCTGTGCTGGCCCTGGTGCCCCAGGATCAGGGACGTCAGGTTGAGAAGAT
CGTTATTGGCTCGGGAGCACAGGCTCAAAAAGGACTGGACAACAAACCCTCGTGCATCTCGCCC
TCACCCTCTAGCCTCTCAGAGACTCCCGATCCCCGTCTGCATCCTCAGAGATCCTATTCTTCCA
GGAATCTAGATCCCACATCCCAGCGCCCTGTTGCACAGCCCTCTCGGGAGGCATCTGCATGGGT
GACCACCCTGTCCCCAGCTGTGGATTCTATACTAGATCCAGGGGTTCAACAGCTGCCATTGGGG
GAACCAGAAACTGACTTCAGCCCCGAGCTTCCTGCTGCCCACCTCATAGGCGCTTGGATGAGCG
GGCAAGGGCTCAGCTGGGAGGCGAGCCAAGAAGAAGCGTTTCTGAGAAGCGGTGCGCAGTTCTC
CCGCACCCATGGGCTGGCGCTGCCTCAGGACGGCGTCTACTATCTCTACTGCCATGTCGGGTAT
CGGGGCCGGACGCCCCCTGCCGGCCGAAGCCGCGCTCGCTTGTTCACGCTGCGCAGCGCCCTGT
ACCGCGCGGGGGGCGCCTATGGGCGGGGCTCCCCCGAGCTGCTGCTGGAGGGCGCGGAGACCGT
GACCCCTGTTGTGGATCCCATCGGGTACGGGTCTTTGTGGTACACGAGCGTGGGGTTCGGCGGC
CTGGCGCAGCTCCGGAGCGGCGAGAGGATATACGTCAACATCAGTCATCCCGACATGGTGGACT
ACAGGAGAGGGAAGACCTTCTTCGGGGCGGTGATGGTGGGGTGACAGCCAACTGCATTCCTGGA
GGATCTACTGACGGTGCGAATGTGTGAATCATGATGTCTGGCGAGTCAAGAAGCCTGGGACCCC
AGGATCCGGGACAGCTAGGGGCGTGGCGCGGGGTTCGGGAGATGTAGGACACGAATTTTGAAAA
TAAAGAATGTAAACTAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_997672	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH88208	(Get FASTA)	NCBI Sequence Viewer
	CAE84002	(Get FASTA)	NCBI Sequence Viewer
	EDL83546	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000098420
	ENSRNOP00000098420.2

RefSeq Acc Id:

NP_997672 ⟸ NM_212507

- UniProtKB:

Q6MG45 (UniProtKB/TrEMBL), F7EMS9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRQVEKIVIGSGA
QAQKGLDNKPSCISPSPSSLSETPDPRLHPQRSYSSRNLDPTSQRPVAQPSREASAWVTTLSPA
VDSILDPGVQQLPLGEPETDFSPELPAAHLIGAWMSGQGLSWEASQEEAFLRSGAQFSRTHGLA
LPQDGVYYLYCHVGYRGRTPPAGRSRARLFTLRSALYRAGGAYGRGSPELLLEGAETVTPVVDP
IGYGSLWYTSVGFGGLAQLRSGERIYVNISHPDMVDYRRGKTFFGAVMVG

hide sequence

Ensembl Acc Id:

ENSRNOP00000072122 ⟸ ENSRNOT00000089411

Ensembl Acc Id:

ENSRNOP00000069775 ⟸ ENSRNOT00000079503

Ensembl Acc Id:

ENSRNOP00000001108 ⟸ ENSRNOT00000001108

Ensembl Acc Id:

ENSRNOP00000098420 ⟸ ENSRNOT00000120807

Protein Domains

THD

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6MG45-F1-model_v2	AlphaFold	Q6MG45	1-306	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303162	AgrOrtholog
BioCyc Gene	G2FUF-4659	BioCyc
Ensembl Genes	ENSRNOG00000000836	Ensembl
	ENSRNOG00000058566	Ensembl
	ENSRNOG00000070531	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000120807	ENTREZGENE
	ENSRNOT00000120807.2	UniProtKB/TrEMBL
Gene3D-CATH	2.60.120.40	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7381953	IMAGE-MGC_LOAD
InterPro	TNF_a/b/c	UniProtKB/TrEMBL
	TNF_C	UniProtKB/TrEMBL
	TNF_CS	UniProtKB/TrEMBL
	TNF_family	UniProtKB/TrEMBL
	Tumour_necrosis_fac-like	UniProtKB/TrEMBL
KEGG Report	rno:361795	UniProtKB/TrEMBL
MGC_CLONE	MGC:108924	IMAGE-MGC_LOAD
NCBI Gene	361795	ENTREZGENE
PANTHER	PTHR11471:SF29	UniProtKB/TrEMBL
	TUMOR NECROSIS FACTOR FAMILY MEMBER	UniProtKB/TrEMBL
Pfam	TNF	UniProtKB/TrEMBL
PhenoGen	Ltb	PhenoGen
PRINTS	TNECROSISFCT	UniProtKB/TrEMBL
	TNFC	UniProtKB/TrEMBL
PROSITE	TNF_1	UniProtKB/TrEMBL
	TNF_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000000836	RatGTEx
	ENSRNOG00000058566	RatGTEx
	ENSRNOG00000070531	RatGTEx
SMART	TNF	UniProtKB/TrEMBL
Superfamily-SCOP	TNF_like	UniProtKB/TrEMBL
UniProt	F7EMS9	ENTREZGENE, UniProtKB/TrEMBL
	Q6MG45	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Ltb	lymphotoxin beta	LOC103694381	lymphotoxin-beta	Data merged from RGD:9083628	737654	PROVISIONAL
2015-11-30	Ltb	lymphotoxin beta	Ltb	lymphotoxin beta (TNF superfamily, member 3)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2014-08-25	LOC103694381	lymphotoxin-beta			Symbol and Name status set to provisional	70820	PROVISIONAL
2008-09-18	Ltb	lymphotoxin beta (TNF superfamily, member 3)	Ltb	lymphotoxin B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-07-14	Ltb	lymphotoxin B			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)