Advanced Search (OLGA)

Gene: Ly6g6e (lymphocyte antigen 6 family member G6E) Rattus norvegicus

Analyze

Symbol:

Ly6g6e

Name:

lymphocyte antigen 6 family member G6E

RGD ID:

1303112

Description:

Predicted to enable acetylcholine receptor activator activity and acetylcholine receptor binding activity. Predicted to be involved in acetylcholine receptor signaling pathway and desensitization of G protein-coupled receptor signaling pathway. Predicted to be located in membrane and synapse. Predicted to be active in plasma membrane. Orthologous to human LY6G6E (lymphocyte antigen 6 family member G6E (pseudogene)); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; alpha-Zearalanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

lymphocyte antigen 6 complex G6E; lymphocyte antigen 6 complex, locus G6E

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,749,352 - 3,752,578 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	3,749,656 - 3,751,392 (-)	Ensembl				GRCr8
mRatBN7.2	20	3,744,999 - 3,749,867 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,744,999 - 3,750,849 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	4,444,330 - 4,446,202 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,806,383 - 3,808,255 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,344,227 - 4,346,110 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,063,148 - 5,069,032 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,067,330 - 5,068,624 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	7,137,208 - 7,141,962 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	3,808,707 - 3,810,443 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	4,279,251 - 4,280,984 (+)	NCBI		Celera
RGSC_v3.1	20	3,808,933 - 3,810,670 (-)	NCBI
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

copper atom (EXP)

copper(0) (EXP)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

genistein (ISO)

glyphosate (EXP)

methapyrilene (ISO)

mono(2-ethylhexyl) phthalate (ISO)

paraquat (EXP)

perfluorooctanoic acid (EXP)

pirinixic acid (ISO)

titanium dioxide (ISO)

triphenyl phosphate (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acetylcholine receptor signaling pathway (ISO)

cell surface receptor protein serine/threonine kinase signaling pathway (IEA)

desensitization of G protein-coupled receptor signaling pathway (ISO)

Cellular Component

membrane (IEA)

plasma membrane (IEA,ISO)

synapse (IEA)

Molecular Function

acetylcholine receptor activator activity (IEA,ISO)

acetylcholine receptor binding (IEA,ISO)

transmembrane receptor protein serine/threonine kinase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	The genomic sequence and comparative analysis of the rat major histocompatibility complex.	Hurt P, etal., Genome Res 2004 Apr;14(4):631-9.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:26276394

Genomics

Comparative Map Data

Ly6g6e
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	3,749,352 - 3,752,578 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	20	3,749,656 - 3,751,392 (-)	Ensembl				GRCr8
mRatBN7.2	20	3,744,999 - 3,749,867 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	3,744,999 - 3,750,849 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	20	4,444,330 - 4,446,202 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	3,806,383 - 3,808,255 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	4,344,227 - 4,346,110 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,063,148 - 5,069,032 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,067,330 - 5,068,624 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	20	7,137,208 - 7,141,962 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	20	3,808,707 - 3,810,443 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	20	4,279,251 - 4,280,984 (+)	NCBI		Celera
RGSC_v3.1	20	3,808,933 - 3,810,670 (-)	NCBI
Cytogenetic Map	20	p12	NCBI

LY6G6E
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	31,711,976 - 31,714,065 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	31,712,341 - 31,713,812 (-)	Ensembl			hg38	GRCh38
GRCh37	6	31,679,753 - 31,681,842 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	31,788,092 - 31,789,568 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	6	31,788,091 - 31,789,568	NCBI
Celera	6	33,277,981 - 33,280,070 (-)	NCBI		Celera
Cytogenetic Map	6	p21.33	NCBI
HuRef	6	31,465,981 - 31,468,070 (-)	NCBI		HuRef
CHM1_1	6	31,681,870 - 31,683,959 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	31,565,011 - 31,567,100 (-)	NCBI		T2T-CHM13v2.0

Ly6g6e
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	35,295,843 - 35,297,781 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	35,295,878 - 35,297,780 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	17	35,076,868 - 35,078,804 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	35,076,902 - 35,078,804 (+)	Ensembl			mm10	GRCm38
MGSCv37	17	35,213,887 - 35,215,749 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	17	34,684,998 - 34,686,860 (+)	NCBI		MGSCv36	mm8
Celera	17	38,173,630 - 38,175,492 (+)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	18.59	NCBI

LOC102154767
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	1,189,910 - 1,196,762 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	1,326,477 - 1,335,548 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	1,335,285 - 1,344,365 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
UMICH_Zoey_3.1	12	1,194,600 - 1,203,661 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	1,261,776 - 1,270,868 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	1,329,227 - 1,338,498 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

LOC110261493
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	7	23,823,392 - 23,825,431 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

Variants

Variants in Ly6g6e
69 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	75
Count of miRNA genes:	57
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000037482
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1533200	5306452	Rat
61474	Eae1	Experimental allergic encephalomyelitis QTL 1	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	20	1	6693431	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1	33724594	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	1	26925056	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26128279	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1533083	46533083	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600300	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24164241	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	1	34066551	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3626323	10078622	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29193376	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	6693431	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3626323	9244918	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	1	27341128	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29193376	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29193376	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29193376	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29193376	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1	14100378	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27341128	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578510	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600300	Rat

Markers in Region

RH135060

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,745,135 - 3,745,327 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	5,068,704 - 5,068,895	NCBI	Rnor6.0
Rnor_5.0	20	7,141,634 - 7,141,825	UniSTS	Rnor5.0
RGSC_v3.4	20	3,808,844 - 3,809,035	UniSTS	RGSC3.4
Celera	20	4,280,656 - 4,280,847	UniSTS
RH 3.4 Map	20	52.3	UniSTS
Cytogenetic Map	20	p12	UniSTS

UniSTS:498506

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	3,745,187 - 3,745,935 (-)	MAPPER	mRatBN7.2
Rnor_6.0	20	5,068,096 - 5,068,843	NCBI	Rnor6.0
Rnor_5.0	20	7,141,026 - 7,141,773	UniSTS	Rnor5.0
RGSC_v3.4	20	3,808,896 - 3,809,643	UniSTS	RGSC3.4
Celera	20	4,280,048 - 4,280,795	UniSTS
Cytogenetic Map	20	p12	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	9	64	160	69	68	40	72	40	6	306	167	11	139	76	89	28	16	16

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001001972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006256072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017601721	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039098955	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC094348	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU253681	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU253682	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KU253683	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000037482 ⟹ ENSRNOP00000032019

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	20	3,749,656 - 3,751,392 (-)	Ensembl
mRatBN7.2 Ensembl	20	3,744,999 - 3,750,849 (-)	Ensembl
Rnor_6.0 Ensembl	20	5,067,330 - 5,068,624 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000113254 ⟹ ENSRNOP00000083250

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	3,744,999 - 3,747,122 (-)	Ensembl

RefSeq Acc Id:

NM_001001972 ⟹ NP_001001972

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,749,656 - 3,751,392 (-)	NCBI
mRatBN7.2	20	3,744,999 - 3,746,736 (-)	NCBI
Rnor_6.0	20	5,067,296 - 5,069,032 (+)	NCBI
Rnor_5.0	20	7,137,208 - 7,141,962 (+)	NCBI
RGSC_v3.4	20	3,808,707 - 3,810,443 (-)	RGD
Celera	20	4,279,251 - 4,280,984 (+)	RGD

Sequence:

show sequence

GTCTTGGGCAGGTGTGTCTGACTTTGGGTACAGGTCTTCCAGACTGCAGAGCCGTTCCTGCCAT
GGGGCTGTCCAGCGCCTTCCTTGGCCTCCTGTTCCTCTCGGGGACACTGGGTCTCACCACTTCC
CCAACCAGAGGACGACTCCACTGTTACACCTGCAGCTTTGCCAAGCCCTGCTACCCTGTTCTCA
CGGAGTGTCGGGAAGATGAGGTGTGCGGTGTCAGTGTTGGCACCTCAGAGCAAAACAAGGATGT
CATCGAGCGGAAAGGCTGCCTCCCAAGAGCCCAGTGCCCTCTGCTGGGCCATACTACCTACTGG
TCACGGTCCTACACTCTCCAGCATCAGTGCTGTGAGCAGGATCTGTGCAACACTGCTGCCTCAC
AGCGACCCCCCAGCCTTCCCCTCATGACTCTGCTACCCCTTGCAGCCATCTTTGGCTGGAGAGT
ACATATCGTCCTCTAGCCCGTGCGTCCACGACTGTCAGCCCGGGACTCCAGTGTCACCGTGGGC
ATGAAAACACCTGCACAGACGCCCTTGAGACACACCCAAGAACATCACTTTGTATAAAAACCTC
AGCCACCGAACCCAGTACAGATCCGGTTCCTACAGCTGGAGTTCCGCTTCCCGCATGCAAGTGT
CCAGAACCTCACCTCATAAGAGACCCTGGCTGCCTTTAACCTACATGTCCCAGGTCAGCTACCC
TGAATGAGCCGTGGGGTCCCAGGCAAAGGGACAGAAGTGGCACTGGGGCTGGTGAGAAATAGAG
TACTGCGAAGGGAAATGAGACTTGGTGCCTGAGGGTCTCAAGAACAGAGGGCTACCTTGGGGAG
CCATAAAGAGTGTATTTAATAAAACGGGCTGTTGGGTAGAGATAGCTCATTGAGTGCTTGCCTA
CCATACACAGGGCCCTGGGTTCTACCCCCTACACCACCCATCAATCAATCAGTCGGTCAATAA

hide sequence

RefSeq Acc Id:

XM_039098953 ⟹ XP_038954881

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,749,352 - 3,752,578 (-)	NCBI
mRatBN7.2	20	3,745,085 - 3,749,867 (-)	NCBI

RefSeq Acc Id:

XM_039098955 ⟹ XP_038954883

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	3,749,352 - 3,752,578 (-)	NCBI
mRatBN7.2	20	3,745,085 - 3,748,163 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001001972	(Get FASTA)	NCBI Sequence Viewer
	XP_038954881	(Get FASTA)	NCBI Sequence Viewer
	XP_038954883	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	APT43277	(Get FASTA)	NCBI Sequence Viewer
	APT43278	(Get FASTA)	NCBI Sequence Viewer
	APT43279	(Get FASTA)	NCBI Sequence Viewer
	CAE83989	(Get FASTA)	NCBI Sequence Viewer
	EDL83509	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000032019
	ENSRNOP00000032019.4

RefSeq Acc Id:	NP_001001972 ⟸ NM_001001972
- Peptide Label:	precursor
- UniProtKB:	Q6MG57 (UniProtKB/TrEMBL), A6KTS9 (UniProtKB/TrEMBL), A0A1L6ZA33 (UniProtKB/TrEMBL), A0A1L6ZA28 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGLSSAFLGLLFLSGTLGLTTSPTRGRLHCYTCSFAKPCYPVLTECREDEVCGVSVGTSEQNKD VIERKGCLPRAQCPLLGHTTYWSRSYTLQHQCCEQDLCNTAASQRPPSLPLMTLLPLAAIFGWR VHIVL hide sequence

Ensembl Acc Id:

ENSRNOP00000032019 ⟸ ENSRNOT00000037482

RefSeq Acc Id:	XP_038954881 ⟸ XM_039098953
- Peptide Label:	isoform X1
- UniProtKB:	A0A1L6ZA28 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038954883 ⟸ XM_039098955
- Peptide Label:	isoform X2
- UniProtKB:	F7FAA3 (UniProtKB/TrEMBL), A0A1L6ZA28 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000083250 ⟸ ENSRNOT00000113254

Protein Domains

Activin types I and II receptor UPAR/Ly6

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6MG57-F1-model_v2	AlphaFold	Q6MG57	1-133	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303112	AgrOrtholog
BioCyc Gene	G2FUF-4640	BioCyc
Ensembl Genes	ENSRNOG00000027157	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000037482	ENTREZGENE
	ENSRNOT00000037482.5	UniProtKB/TrEMBL
Gene3D-CATH	2.10.60.10	UniProtKB/TrEMBL
InterPro	Activin_recp	UniProtKB/TrEMBL
	LY6_UPA_recep-like	UniProtKB/TrEMBL
	Ly6g6e	UniProtKB/TrEMBL
	Snake_toxin-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:406866	UniProtKB/TrEMBL
NCBI Gene	406866	ENTREZGENE
PANTHER	LYMPHOCYTE ANTIGEN 6 FAMILY MEMBER G6E	UniProtKB/TrEMBL
	PTHR14569	UniProtKB/TrEMBL
Pfam	Activin_recp	UniProtKB/TrEMBL
	UPAR_LY6	UniProtKB/TrEMBL
PhenoGen	Ly6g6e	PhenoGen
RatGTEx	ENSRNOG00000027157	RatGTEx
Superfamily-SCOP	SSF57302	UniProtKB/TrEMBL
UniProt	A0A1L6ZA28	ENTREZGENE, UniProtKB/TrEMBL
	A0A1L6ZA29_RAT	UniProtKB/TrEMBL
	A0A1L6ZA33	ENTREZGENE, UniProtKB/TrEMBL
	A6KTS9	ENTREZGENE, UniProtKB/TrEMBL
	F7FAA3	ENTREZGENE
	Q6MG57	ENTREZGENE
UniProt Secondary	F7FAA3	UniProtKB/TrEMBL
	Q6MG57	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-02-01	Ly6g6e	lymphocyte antigen 6 family member G6E	Ly6g6e	lymphocyte antigen 6 complex, locus G6E	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-02-14	Ly6g6e	lymphocyte antigen 6 complex, locus G6E			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message