Pfdn6 (prefoldin subunit 6) - Rat Genome Database

Name: Pfdn6
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Pfdn6 (prefoldin subunit 6) Rattus norvegicus

Analyze

Symbol:

Pfdn6

Name:

prefoldin subunit 6

RGD ID:

1303006

Description:

Predicted to enable amyloid-beta binding activity; protein-folding chaperone binding activity; and unfolded protein binding activity. Predicted to be involved in chaperone-mediated protein complex assembly; negative regulation of amyloid fibril formation; and protein folding. Predicted to be part of RPAP3/R2TP/prefoldin-like complex and prefoldin complex. Predicted to be active in cytoplasm. Orthologous to human PFDN6 (prefoldin subunit 6); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Ke2; MHC class II region expressed gene KE2; prefoldin 6

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PFDN6 (prefoldin subunit 6)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pfdn6 (prefoldin subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pfdn6 (prefoldin subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PFDN6 (prefoldin subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PFDN6 (prefoldin subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pfdn6 (prefoldin subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PFDN6 (prefoldin subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PFDN6 (prefoldin subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pfdn6 (prefoldin subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Pfdn6 (prefoldin subunit 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PFDN6 (prefoldin subunit 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pfdn6 (prefoldin subunit 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pfd-6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pfdn6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	YKE2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	pfdn6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	4,947,844 - 4,949,318 (+)	NCBI		GRCr8
mRatBN7.2	20	4,945,959 - 4,947,433 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	4,945,959 - 4,947,433 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	5,669,442 - 5,670,913 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	5,031,187 - 5,032,658 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	5,511,980 - 5,513,454 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,455,974 - 5,457,448 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,455,974 - 5,457,444 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	7,514,586 - 7,516,060 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	5,097,725 - 5,099,199 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	5,097,988 - 5,099,417 (+)	NCBI
Celera	20	6,530,176 - 6,531,651 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant intellectual developmental disorder 5 (ISO)

MHC class I deficiency (ISO)

proteasome-associated autoinflammatory syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

4,4'-sulfonyldiphenol (EXP)

aflatoxin B1 (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

carbon nanotube (ISO)

CGP 52608 (ISO)

clobetasol (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

Cuprizon (EXP)

DDE (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

diethylstilbestrol (ISO)

epoxiconazole (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

ivermectin (ISO)

nefazodone (EXP)

paracetamol (EXP)

pirinixic acid (ISO)

sodium arsenite (ISO)

sulindac (EXP)

tert-butyl hydroperoxide (ISO)

tetrachloromethane (EXP)

thalidomide (ISO)

thiram (ISO)

titanium dioxide (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

chaperone-mediated protein complex assembly (IBA,ISO)

negative regulation of amyloid fibril formation (ISO)

protein folding (IBA,ISO)

Cellular Component

cytoplasm (IBA)

prefoldin complex (IBA,ISO)

RPAP3/R2TP/prefoldin-like complex (ISO)

Molecular Function

amyloid-beta binding (ISO)

protein binding (ISO)

protein-folding chaperone binding (IBA,ISO)

unfolded protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Expressional patterns of chaperones in ten human tumor cell lines.	Myung JK, etal., Proteome Sci 2004 Dec 14;2(1):8.
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:9630229	PMID:15060004	PMID:31505169

Genomics

Comparative Map Data

Pfdn6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	20	4,947,844 - 4,949,318 (+)	NCBI		GRCr8
mRatBN7.2	20	4,945,959 - 4,947,433 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	4,945,959 - 4,947,433 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	5,669,442 - 5,670,913 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	5,031,187 - 5,032,658 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	5,511,980 - 5,513,454 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	5,455,974 - 5,457,448 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	5,455,974 - 5,457,444 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	7,514,586 - 7,516,060 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	5,097,725 - 5,099,199 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	5,097,988 - 5,099,417 (+)	NCBI
Celera	20	6,530,176 - 6,531,651 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

PFDN6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	33,289,197 - 33,290,934 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	33,289,302 - 33,298,401 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	33,257,374 - 33,258,711 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	33,365,356 - 33,366,689 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	33,365,355 - 33,366,689	NCBI
Celera	6	34,811,736 - 34,813,069 (+)	NCBI		Celera
Cytogenetic Map	6	p21.32	NCBI
HuRef	6	32,999,008 - 33,000,345 (+)	NCBI		HuRef
CHM1_1	6	33,259,314 - 33,260,651 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	6	33,110,554 - 33,112,296 (+)	NCBI		T2T-CHM13v2.0

Pfdn6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	17	34,157,883 - 34,159,317 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	17	34,157,795 - 34,159,317 (-)	Ensembl		GRCm39 Ensembl
GRCm38	17	33,938,909 - 33,940,343 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	17	33,938,821 - 33,940,343 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	17	34,075,854 - 34,077,288 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	17	33,549,377 - 33,550,759 (-)	NCBI		MGSCv36	mm8
Celera	17	36,691,821 - 36,693,255 (-)	NCBI		Celera
Cytogenetic Map	17	B1	NCBI
cM Map	17	17.98	NCBI

Pfdn6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955437	1,848,571 - 1,849,824 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955437	1,848,571 - 1,849,824 (+)	NCBI	ChiLan1.0	ChiLan1.0

PFDN6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	5	47,767,049 - 47,768,838 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	6	43,638,721 - 43,640,506 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	32,861,793 - 32,863,234 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	33,975,889 - 33,977,304 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	33,975,992 - 33,983,245 (+)	Ensembl	panpan1.1		panPan2

PFDN6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	2,729,562 - 2,730,858 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	12	2,729,562 - 2,737,163 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	2,810,481 - 2,811,777 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	3,060,976 - 3,062,272 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	12	3,060,976 - 3,068,578 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	12	2,728,205 - 2,729,498 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	2,809,691 - 2,810,986 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	2,884,403 - 2,885,699 (+)	NCBI		UU_Cfam_GSD_1.0

Pfdn6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	38,383,438 - 38,384,733 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936476	25,575,534 - 25,576,818 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936476	25,575,534 - 25,576,827 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PFDN6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	29,653,679 - 29,654,945 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	29,653,569 - 29,654,957 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	34,157,268 - 34,158,709 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PFDN6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	38,786,556 - 38,787,913 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	38,786,045 - 38,787,613 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	33,124,206 - 33,125,566 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pfdn6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624754	23,531,016 - 23,532,388 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624754	23,531,016 - 23,532,350 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pfdn6
23 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	44
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000000553
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2306850	Pia40	Pristane induced arthritis QTL 40		0.0001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	1527959	5304575	Rat
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7175096	Tcs1	T cell selection QTL 1			T cell selection trait (VT:0004917)	expression	20	4727078	5024580	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
61474	Eae1	Experimental allergic encephalomyelitis QTL 1	3		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	20	4606607	6691706	Rat
7387283	Uae44	Urinary albumin excretion QTL 44		0.1712	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	20	1	26123605	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
1331772	Cdexp2	CD45RC expression in CD8 T cells QTL 2	5.7		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	20	3621649	10078919	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
1300152	Bp195	Blood pressure QTL 195	3.46		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	20	3621649	9243559	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001164718	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_212506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC128962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BX883042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000020	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000000553 ⟹ ENSRNOP00000000553

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	4,945,959 - 4,947,433 (+)	Ensembl
Rnor_6.0 Ensembl	20	5,455,974 - 5,457,444 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092555 ⟹ ENSRNOP00000075836

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	5,456,235 - 5,457,444 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092676 ⟹ ENSRNOP00000075862

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	5,455,974 - 5,457,444 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000092723

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	5,456,013 - 5,456,724 (+)	Ensembl

RefSeq Acc Id:

NM_001164718 ⟹ NP_001158190

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	4,947,844 - 4,949,318 (+)	NCBI
mRatBN7.2	20	4,945,959 - 4,947,433 (+)	NCBI
Rnor_6.0	20	5,455,974 - 5,457,448 (+)	NCBI
Rnor_5.0	20	7,514,586 - 7,516,060 (+)	NCBI
RGSC_v3.4	20	5,097,725 - 5,099,199 (+)	RGD
Celera	20	6,530,176 - 6,531,651 (+)	RGD

Sequence:

show sequence

TTGTTTATTTCCGGGTTTATGAATACAGAGGGCAGAGCGTGAAAAGGGCCAGGAAGGGGAGCTC
AGGTGCTTTTCAGAGCTTGAGACCCAGCGACCCCCGCCCAGGAGGCTTTCTCCTTCACCATGGC
CGAACTGATCCAAAAGAAGCTGCAGGGAGAGGTAGAGAAATATCAACAGCTGCAGAAGGACTTG
AGTAAATCCATGTCAGGGAGGCAGAAGCTTGAAGCCCAGCTAACGGAAAATAACATTGTGAAGG
AGGAACTGGCCTTGCTGGATGGATCCAACGTGGTCTTTAAGCTTCTGGGACCCGTGCTTGTCAA
ACAGGAGCTGGGGGAGGCTCGGGCCACAGTGGGGAAGAGGCTAGACTACATCACAGCGGAAATT
AAGCGCTACGAATCGCAGCTTCGGGACCTCGAAAGGCAGTCAGAGCAACAGAGGGAAACCCTTG
CTCAGTTGCAGCAGGAGTTCCAGCGGGCCCAGAACGCAAAGGCTCCCGGGAAAGCCTGACCCCG
TGGGAGGGGGAGGGGGCTGGGGAGGGAGGGATGAGGCTAACCCTGAGTCAATAAAATGTAAACA
GAACCAAACCTA

hide sequence

RefSeq Acc Id:

NM_212506 ⟹ NP_997671

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	20	4,947,844 - 4,949,318 (+)	NCBI
mRatBN7.2	20	4,945,959 - 4,947,433 (+)	NCBI
Rnor_6.0	20	5,455,974 - 5,457,448 (+)	NCBI
Rnor_5.0	20	7,514,586 - 7,516,060 (+)	NCBI
RGSC_v3.4	20	5,097,725 - 5,099,199 (+)	RGD
Celera	20	6,530,176 - 6,531,651 (+)	RGD

Sequence:

show sequence

TTGTTTATTTCCGGGTTTATGAATACAGAGGGCAGAGCGTGAAAAGGTTAGGGTTTGGATTTAG
GGGGGTGTCTCTTCTTTTCGCTCTCTAATGCCTAGGGAGTGACTATTCTGGACGTAGAGAGTCC
ACGGTAGCTCGTGCTGTCCTTCTGCAGGGCCAGGAAGGGGAGCTCAGGTGCTTTTCAGAGCTTG
AGACCCAGCGACCCCCGCCCAGGAGGCTTTCTCCTTCACCATGGCCGAACTGATCCAAAAGAAG
CTGCAGGGAGAGGTAGAGAAATATCAACAGCTGCAGAAGGACTTGAGTAAATCCATGTCAGGGA
GGCAGAAGCTTGAAGCCCAGCTAACGGAAAATAACATTGTGAAGGAGGAACTGGCCTTGCTGGA
TGGATCCAACGTGGTCTTTAAGCTTCTGGGACCCGTGCTTGTCAAACAGGAGCTGGGGGAGGCT
CGGGCCACAGTGGGGAAGAGGCTAGACTACATCACAGCGGAAATTAAGCGCTACGAATCGCAGC
TTCGGGACCTCGAAAGGCAGTCAGAGCAACAGAGGGAAACCCTTGCTCAGTTGCAGCAGGAGTT
CCAGCGGGCCCAGAACGCAAAGGCTCCCGGGAAAGCCTGACCCCGTGGGAGGGGGAGGGGGCTG
GGGAGGGAGGGATGAGGCTAACCCTGAGTCAATAAAATGTAAACAGAACCAAACCTA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001158190	(Get FASTA)	NCBI Sequence Viewer
	NP_997671	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAE83922	(Get FASTA)	NCBI Sequence Viewer
	EDL96846	(Get FASTA)	NCBI Sequence Viewer
	EDL96847	(Get FASTA)	NCBI Sequence Viewer
	EDL96848	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000000553.2

RefSeq Acc Id:	NP_997671 ⟸ NM_212506
- UniProtKB:	Q6MGC4 (UniProtKB/TrEMBL), F7EQJ2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVL VKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQNAKAPGKA hide sequence

RefSeq Acc Id:	NP_001158190 ⟸ NM_001164718
- UniProtKB:	Q6MGC4 (UniProtKB/TrEMBL), F7EQJ2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVL VKQELGEARATVGKRLDYITAEIKRYESQLRDLERQSEQQRETLAQLQQEFQRAQNAKAPGKA hide sequence

Ensembl Acc Id:

ENSRNOP00000075862 ⟸ ENSRNOT00000092676

Ensembl Acc Id:

ENSRNOP00000075836 ⟸ ENSRNOT00000092555

Ensembl Acc Id:

ENSRNOP00000000553 ⟸ ENSRNOT00000000553

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6MGC4-F1-model_v2	AlphaFold	Q6MGC4	1-127	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13701413

Promoter ID:

EPDNEW_R11936

Type:

multiple initiation site

Name:

Pfdn6_1

Description:

prefoldin subunit 6

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	20	5,455,996 - 5,456,056	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1303006	AgrOrtholog
BioCyc Gene	G2FUF-4517	BioCyc
Ensembl Genes	ENSRNOG00000000473	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000553.7	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.370	UniProtKB/TrEMBL
InterPro	PFD_beta-like	UniProtKB/TrEMBL
	Prefoldin	UniProtKB/TrEMBL
KEGG Report	rno:309629	UniProtKB/TrEMBL
NCBI Gene	309629	ENTREZGENE
PANTHER	PREFOLDIN SUBUNIT 6	UniProtKB/TrEMBL
	PREFOLDIN SUBUNIT 6	UniProtKB/TrEMBL
Pfam	Prefoldin_2	UniProtKB/TrEMBL
PharmGKB	PFDN6	RGD
PhenoGen	Pfdn6	PhenoGen
RatGTEx	ENSRNOG00000000473	RatGTEx
Superfamily-SCOP	Prefoldin	UniProtKB/TrEMBL
UniProt	F7EQJ2	ENTREZGENE, UniProtKB/TrEMBL
	Q6MGC4	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-10-22	Pfdn6	prefoldin subunit 6	Pfdn6	prefoldin 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-11	Pfdn6	prefoldin 6	Pfdn6	prefoldin subunit 6	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-04	Pfdn6	prefoldin subunit 6	Ke2	MHC class II region expressed gene KE2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Ke2	MHC class II region expressed gene KE2			Symbol and Name status set to approved	1299863	APPROVED
2005-02-14	Ke2	MHC class II region expressed gene KE2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar