Symbol:
Ddah2
Name:
DDAH family member 2, ADMA-independent
RGD ID:
1302955
Description:
Predicted to be located in mitochondrion. Orthologous to human DDAH2 (DDAH family member 2, ADMA-independent); INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol 3-benzoate; 2,3,7,8-tetrachlorodibenzodioxine.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
DDAH-2; DDAHII; dimethylargininase-2; dimethylarginine dimethylaminohydrolase 2; inactive dimethylarginine dimethylaminohydrolase 2; inactive N(G),N(G)-dimethylarginine dimethylaminohydrolase 2; MGC105993; n(G),N(G)-dimethylarginine dimethylaminohydrolase 2; putative hydrolase DDAH2
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
DDAH2 (DDAH family member 2, ADMA-independent) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):
Ddah2 (DDAH family member 2, ADMA independent) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Ddah2 (DDAH family member 2, ADMA-independent) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
DDAH2 (DDAH family member 2, ADMA-independent) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
DDAH2 (DDAH family member 2, ADMA-independent) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Ddah2 (DDAH family member 2, ADMA-independent) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
DDAH2 (DDAH family member 2, ADMA-independent) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
DDAH2 (DDAH family member 2, ADMA-independent) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Ddah2 (DDAH family member 2, ADMA-independent) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Alliance orthologs 3
Homo sapiens (human):
DDAH2 (DDAH family member 2, ADMA-independent)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Mus musculus (house mouse):
Ddah2 (DDAH family member 2, ADMA independent)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
ddah2 (dimethylarginine dimethylaminohydrolase 2)
Alliance
DIOPT (Ensembl Compara|InParanoid|OMA|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Drosophila melanogaster (fruit fly):
CG1764
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OrthoFinder|OrthoInspector|PANTHER|SonicParanoid)
Caenorhabditis elegans (roundworm):
T22B7.3
Alliance
DIOPT (Ensembl Compara|Hieranoid)
Caenorhabditis elegans (roundworm):
F38H4.5
Alliance
DIOPT (Ensembl Compara|Hieranoid)
Xenopus tropicalis (tropical clawed frog):
ddah2
Alliance
DIOPT (Ensembl Compara|OMA|OrthoFinder|PANTHER|PhylomeDB)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,766,115 - 3,769,161 (-) NCBI GRCr8 mRatBN7.2 20 3,761,460 - 3,764,718 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,761,465 - 3,764,511 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,460,950 - 4,463,996 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,823,004 - 3,826,050 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,360,895 - 4,363,941 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,049,260 - 5,052,573 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,049,496 - 5,052,585 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,122,457 - 7,125,503 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,829,767 - 3,836,141 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,829,994 - 3,831,997 (-) NCBI Celera 20 4,261,560 - 4,264,603 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Ddah2 Rat 1,2-dimethylhydrazine increases expression ISO Ddah2 (Mus musculus) 6480464 1 and 2-Dimethylhydrazine results in increased expression of DDAH2 mRNA CTD PMID:22206623 Ddah2 Rat 17alpha-ethynylestradiol decreases expression ISO Ddah2 (Mus musculus) 6480464 Ethinyl Estradiol results in decreased expression of DDAH2 mRNA CTD PMID:17555576 Ddah2 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of DDAH2 mRNA CTD PMID:26865667 Ddah2 Rat 17alpha-ethynylestradiol affects expression ISO DDAH2 (Homo sapiens) 6480464 Ethinyl Estradiol affects the expression of DDAH2 mRNA CTD PMID:26865667 Ddah2 Rat 17alpha-ethynylestradiol decreases expression EXP 6480464 Ethinyl Estradiol results in decreased expression of DDAH2 mRNA CTD PMID:17557909 Ddah2 Rat 17beta-estradiol multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Estradiol co-treated with TGFB1 protein] results in increased expression of DDAH2 mRNA and [Progesterone co-treated with Estradiol] results in decreased expression of DDAH2 mRNA CTD PMID:17404688 and PMID:30165855 Ddah2 Rat 17beta-estradiol decreases expression ISO DDAH2 (Homo sapiens) 6480464 Estradiol results in decreased expression of DDAH2 mRNA CTD PMID:23373633 Ddah2 Rat 17beta-estradiol affects expression ISO DDAH2 (Homo sapiens) 6480464 Estradiol affects the expression of DDAH2 mRNA CTD PMID:22574217 Ddah2 Rat 17beta-estradiol 3-benzoate increases methylation EXP 6480464 estradiol 3-benzoate results in increased methylation of DDAH2 promoter CTD PMID:27415467 Ddah2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Ddah2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DDAH2 mRNA CTD PMID:19933214 Ddah2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Ddah2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DDAH2 mRNA CTD PMID:21570461 Ddah2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression EXP 6480464 Tetrachlorodibenzodioxin affects the expression of DDAH2 mRNA CTD PMID:22298810 and PMID:34747641 Ddah2 Rat 2-hydroxypropanoic acid decreases expression ISO DDAH2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of DDAH2 mRNA CTD PMID:30851411 Ddah2 Rat 3,3',5,5'-tetrabromobisphenol A decreases expression ISO Ddah2 (Mus musculus) 6480464 tetrabromobisphenol A results in decreased expression of DDAH2 mRNA CTD PMID:25172293 Ddah2 Rat 4,4'-sulfonyldiphenol increases expression ISO Ddah2 (Mus musculus) 6480464 bisphenol S results in increased expression of DDAH2 mRNA CTD PMID:39298647 Ddah2 Rat 4,4'-sulfonyldiphenol affects methylation ISO Ddah2 (Mus musculus) 6480464 bisphenol S affects the methylation of DDAH2 gene CTD PMID:31683443 Ddah2 Rat 4,4'-sulfonyldiphenol increases expression ISO DDAH2 (Homo sapiens) 6480464 bisphenol S results in increased expression of DDAH2 protein CTD PMID:34186270 Ddah2 Rat 4-hydroxyphenyl retinamide increases expression ISO Ddah2 (Mus musculus) 6480464 Fenretinide results in increased expression of DDAH2 mRNA CTD PMID:28973697 Ddah2 Rat 5-fluorouracil affects response to substance ISO DDAH2 (Homo sapiens) 6480464 DDAH2 protein affects the susceptibility to Fluorouracil CTD PMID:16217747 Ddah2 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DDAH2 mRNA CTD PMID:24780913 Ddah2 Rat acetamide increases expression EXP 6480464 acetamide results in increased expression of DDAH2 mRNA CTD PMID:31881176 Ddah2 Rat actinomycin D multiple interactions ISO DDAH2 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Nebivolol results in increased expression of DDAH2 mRNA] CTD PMID:17977009 Ddah2 Rat all-trans-retinoic acid multiple interactions EXP 6480464 DDAH2 protein promotes the reaction [Tretinoin inhibits the reaction [cobaltous chloride results in increased activity of CASP3 protein]] more ... CTD PMID:19156866 Ddah2 Rat all-trans-retinoic acid decreases expression ISO DDAH2 (Homo sapiens) 6480464 Tretinoin results in decreased expression of DDAH2 mRNA CTD PMID:17218384 Ddah2 Rat amphetamine increases expression EXP 6480464 Amphetamine results in increased expression of DDAH2 mRNA CTD PMID:30779732 Ddah2 Rat antirheumatic drug increases expression ISO DDAH2 (Homo sapiens) 6480464 Antirheumatic Agents results in increased expression of DDAH2 mRNA CTD PMID:24449571 Ddah2 Rat aristolochic acid A increases expression ISO DDAH2 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of DDAH2 mRNA CTD PMID:33212167 Ddah2 Rat benzo[a]pyrene decreases expression ISO Ddah2 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of DDAH2 mRNA CTD PMID:21569818 Ddah2 Rat benzo[a]pyrene decreases expression ISO DDAH2 (Homo sapiens) 6480464 Benzo(a)pyrene results in decreased expression of DDAH2 mRNA CTD PMID:32234424 Ddah2 Rat benzo[a]pyrene affects methylation ISO DDAH2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DDAH2 promoter CTD PMID:27901495 Ddah2 Rat benzo[a]pyrene increases expression ISO Ddah2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of DDAH2 mRNA CTD PMID:22228805 and PMID:32417428 Ddah2 Rat bis(2-ethylhexyl) phthalate decreases expression ISO Ddah2 (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of DDAH2 mRNA CTD PMID:34319233 Ddah2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DDAH2 mRNA CTD PMID:25181051 Ddah2 Rat bisphenol A increases expression ISO Ddah2 (Mus musculus) 6480464 bisphenol A results in increased expression of DDAH2 mRNA CTD PMID:32156529 Ddah2 Rat bisphenol A increases expression ISO DDAH2 (Homo sapiens) 6480464 bisphenol A results in increased expression of DDAH2 protein CTD PMID:37567409 Ddah2 Rat bisphenol A affects methylation ISO DDAH2 (Homo sapiens) 6480464 bisphenol A affects the methylation of DDAH2 gene CTD PMID:31601247 Ddah2 Rat bisphenol A multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of DDAH2 gene CTD PMID:31601247 Ddah2 Rat bisphenol AF increases expression ISO DDAH2 (Homo sapiens) 6480464 bisphenol AF results in increased expression of DDAH2 protein CTD PMID:34186270 Ddah2 Rat bisphenol F increases expression ISO DDAH2 (Homo sapiens) 6480464 bisphenol F results in increased expression of DDAH2 protein CTD PMID:34186270 Ddah2 Rat cadmium dichloride decreases expression ISO DDAH2 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of DDAH2 protein CTD PMID:24419708 Ddah2 Rat cadmium dichloride increases expression ISO DDAH2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of DDAH2 protein CTD PMID:24527689 Ddah2 Rat carbon nanotube decreases expression ISO Ddah2 (Mus musculus) 6480464 Nanotubes and Carbon results in decreased expression of DDAH2 mRNA CTD PMID:25554681 Ddah2 Rat chlorpyrifos increases expression ISO Ddah2 (Mus musculus) 6480464 Chlorpyrifos results in increased expression of DDAH2 mRNA CTD PMID:37019170 Ddah2 Rat cisplatin multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of DDAH2 mRNA CTD PMID:27392435 Ddah2 Rat cisplatin decreases expression ISO DDAH2 (Homo sapiens) 6480464 Cisplatin results in decreased expression of DDAH2 mRNA CTD PMID:27392435 Ddah2 Rat cobalt atom multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of DDAH2 mRNA CTD PMID:18078969 Ddah2 Rat cobalt dichloride decreases expression EXP 6480464 cobaltous chloride results in decreased expression of DDAH2 mRNA and cobaltous chloride results in decreased expression of DDAH2 protein CTD PMID:19156866 Ddah2 Rat cobalt dichloride decreases expression ISO DDAH2 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DDAH2 mRNA CTD PMID:19376846 Ddah2 Rat cobalt dichloride multiple interactions EXP 6480464 DDAH2 protein promotes the reaction [Tretinoin inhibits the reaction [cobaltous chloride results in increased activity of CASP3 protein]] more ... CTD PMID:19156866 Ddah2 Rat copper(II) sulfate decreases expression ISO DDAH2 (Homo sapiens) 6480464 Copper Sulfate results in decreased expression of DDAH2 mRNA CTD PMID:19549813 Ddah2 Rat coumestrol decreases expression ISO DDAH2 (Homo sapiens) 6480464 Coumestrol results in decreased expression of DDAH2 mRNA CTD PMID:19167446 Ddah2 Rat coumestrol multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Ddah2 Rat cyclosporin A decreases expression ISO DDAH2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DDAH2 mRNA CTD PMID:27989131 Ddah2 Rat dibutyl phthalate decreases expression EXP 6480464 Dibutyl Phthalate results in decreased expression of DDAH2 mRNA CTD PMID:21266533 Ddah2 Rat dioxygen decreases expression EXP 6480464 Oxygen deficiency results in decreased expression of DDAH2 protein CTD PMID:27313889 Ddah2 Rat dioxygen increases expression EXP 6480464 Oxygen deficiency results in increased expression of DDAH2 mRNA CTD PMID:27313889 Ddah2 Rat diuron decreases expression EXP 6480464 Diuron results in decreased expression of DDAH2 mRNA CTD PMID:25152437 Ddah2 Rat dorsomorphin multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 Ddah2 Rat doxorubicin decreases expression ISO DDAH2 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DDAH2 mRNA CTD PMID:29803840 Ddah2 Rat elemental selenium increases expression ISO DDAH2 (Homo sapiens) 6480464 Selenium results in increased expression of DDAH2 mRNA CTD PMID:19244175 Ddah2 Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of DDAH2 mRNA CTD PMID:29391264 Ddah2 Rat Enterolactone multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in decreased expression of DDAH2 mRNA CTD PMID:19167446 Ddah2 Rat entinostat decreases expression ISO DDAH2 (Homo sapiens) 6480464 entinostat results in decreased expression of DDAH2 mRNA CTD PMID:26272509 and PMID:27188386 Ddah2 Rat entinostat multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DDAH2 mRNA CTD PMID:27188386 Ddah2 Rat formaldehyde decreases expression ISO DDAH2 (Homo sapiens) 6480464 Formaldehyde results in decreased expression of DDAH2 mRNA and Formaldehyde results in decreased expression of DDAH2 protein CTD PMID:24140967 Ddah2 Rat fulvestrant multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [bisphenol A co-treated with Fulvestrant] results in decreased methylation of DDAH2 gene CTD PMID:31601247 Ddah2 Rat furan increases expression EXP 6480464 furan results in increased expression of DDAH2 mRNA CTD PMID:27387713 Ddah2 Rat genistein affects expression ISO DDAH2 (Homo sapiens) 6480464 Genistein affects the expression of DDAH2 mRNA CTD PMID:26865667 Ddah2 Rat heparin decreases expression EXP 6480464 Heparin results in decreased expression of DDAH2 protein CTD PMID:17488504 Ddah2 Rat indole-3-methanol affects expression EXP 6480464 indole-3-carbinol affects the expression of DDAH2 mRNA CTD PMID:21396975 Ddah2 Rat iron dextran multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Iron-Dextran Complex results in decreased expression of DDAH2 protein] which results in increased abundance of N more ... CTD PMID:32135237 Ddah2 Rat iron dextran decreases expression ISO DDAH2 (Homo sapiens) 6480464 Iron-Dextran Complex results in decreased expression of DDAH2 protein CTD PMID:32135237 Ddah2 Rat ivermectin decreases expression ISO DDAH2 (Homo sapiens) 6480464 Ivermectin results in decreased expression of DDAH2 protein CTD PMID:32959892 Ddah2 Rat L-arginine multiple interactions ISO DDAH2 (Homo sapiens) 6480464 Arginine inhibits the reaction [[Iron-Dextran Complex results in decreased expression of DDAH2 protein] which results in increased abundance of N more ... CTD PMID:32135237 Ddah2 Rat lead(II) chloride increases expression ISO DDAH2 (Homo sapiens) 6480464 lead chloride results in increased expression of DDAH2 protein CTD PMID:24419708 Ddah2 Rat lidocaine increases expression EXP 6480464 Lidocaine results in increased expression of DDAH2 mRNA CTD PMID:27018092 Ddah2 Rat lidocaine decreases expression EXP 6480464 Lidocaine results in decreased expression of DDAH2 protein CTD PMID:27018092 Ddah2 Rat malonaldehyde multiple interactions ISO DDAH2 (Homo sapiens) 6480464 DDAH2 promotes the reaction [tetramethylpyrazine inhibits the reaction [Iron-Dextran Complex results in increased abundance of Malondialdehyde]] CTD PMID:32135237 Ddah2 Rat melatonin multiple interactions EXP 6480464 Melatonin inhibits the reaction [Methotrexate results in decreased expression of DDAH2 protein] CTD PMID:36890697 Ddah2 Rat methotrexate decreases expression EXP 6480464 Methotrexate results in decreased expression of DDAH2 protein CTD PMID:36890697 Ddah2 Rat methotrexate multiple interactions EXP 6480464 Melatonin inhibits the reaction [Methotrexate results in decreased expression of DDAH2 protein] CTD PMID:36890697 Ddah2 Rat morphine multiple interactions EXP 6480464 Morphine deficiency affects the reaction [Morphine deficiency affects the reaction [Morphine results in increased expression of DDAH2 protein]] and Morphine deficiency affects the reaction [Morphine results in increased expression of DDAH2 protein] CTD PMID:23056601 Ddah2 Rat morphine increases expression EXP 6480464 Morphine results in increased expression of DDAH2 protein CTD PMID:23056601 Ddah2 Rat N(omega),N(omega)-dimethyl-L-arginine multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Iron-Dextran Complex results in decreased expression of DDAH2 protein] which results in increased abundance of N more ... CTD PMID:32135237 Ddah2 Rat nebivolol multiple interactions ISO DDAH2 (Homo sapiens) 6480464 Dactinomycin inhibits the reaction [Nebivolol results in increased expression of DDAH2 mRNA] CTD PMID:17977009 Ddah2 Rat nebivolol increases expression ISO DDAH2 (Homo sapiens) 6480464 Nebivolol results in increased expression of DDAH2 mRNA and Nebivolol results in increased expression of DDAH2 protein CTD PMID:17977009 Ddah2 Rat nebivolol increases activity ISO DDAH2 (Homo sapiens) 6480464 Nebivolol results in increased activity of DDAH2 protein CTD PMID:17977009 Ddah2 Rat nickel sulfate increases expression ISO DDAH2 (Homo sapiens) 6480464 nickel sulfate results in increased expression of DDAH2 mRNA CTD PMID:22714537 Ddah2 Rat niclosamide increases expression ISO DDAH2 (Homo sapiens) 6480464 Niclosamide results in increased expression of DDAH2 mRNA CTD PMID:36318118 Ddah2 Rat nitric oxide multiple interactions ISO DDAH2 (Homo sapiens) 6480464 DDAH2 promotes the reaction [tetramethylpyrazine inhibits the reaction [Iron-Dextran Complex results in decreased abundance of Nitric Oxide]] CTD PMID:32135237 Ddah2 Rat ozone multiple interactions ISO Ddah2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in decreased expression of DDAH2 mRNA CTD PMID:34911549 Ddah2 Rat ozone multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which affects the expression of DDAH2 mRNA CTD PMID:35430440 Ddah2 Rat paracetamol affects expression ISO Ddah2 (Mus musculus) 6480464 Acetaminophen affects the expression of DDAH2 mRNA CTD PMID:17562736 Ddah2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of DDAH2 mRNA CTD PMID:33387578 Ddah2 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of DDAH2 mRNA CTD PMID:20388547 Ddah2 Rat paraquat decreases expression EXP 6480464 Paraquat results in decreased expression of DDAH2 mRNA CTD PMID:32680482 Ddah2 Rat progesterone multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Progesterone co-treated with Estradiol] results in decreased expression of DDAH2 mRNA CTD PMID:17404688 Ddah2 Rat rac-lactic acid decreases expression ISO DDAH2 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of DDAH2 mRNA CTD PMID:30851411 Ddah2 Rat reactive oxygen species multiple interactions ISO DDAH2 (Homo sapiens) 6480464 DDAH2 promotes the reaction [tetramethylpyrazine inhibits the reaction [Iron-Dextran Complex results in increased abundance of Reactive Oxygen Species]] CTD PMID:32135237 Ddah2 Rat resveratrol multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [Coumestrol co-treated with resveratrol] results in decreased expression of DDAH2 mRNA CTD PMID:19167446 Ddah2 Rat SB 431542 multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 more ... CTD PMID:27188386 and PMID:37664457 Ddah2 Rat selenium atom increases expression ISO DDAH2 (Homo sapiens) 6480464 Selenium results in increased expression of DDAH2 mRNA CTD PMID:19244175 Ddah2 Rat sodium arsenite increases expression ISO DDAH2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DDAH2 mRNA CTD PMID:22714537 and PMID:38568856 Ddah2 Rat Soman increases expression EXP 6480464 Soman results in increased expression of DDAH2 mRNA CTD PMID:19281266 Ddah2 Rat sulforaphane decreases expression ISO DDAH2 (Homo sapiens) 6480464 sulforaphane results in decreased expression of DDAH2 mRNA CTD PMID:31838189 Ddah2 Rat sunitinib decreases expression ISO DDAH2 (Homo sapiens) 6480464 Sunitinib results in decreased expression of DDAH2 mRNA CTD PMID:31533062 Ddah2 Rat tamoxifen affects expression ISO Ddah2 (Mus musculus) 6480464 Tamoxifen affects the expression of DDAH2 mRNA CTD PMID:17555576 Ddah2 Rat tetramethylpyrazine multiple interactions ISO DDAH2 (Homo sapiens) 6480464 DDAH2 promotes the reaction [tetramethylpyrazine inhibits the reaction [Iron-Dextran Complex results in decreased abundance of Nitric Oxide]] more ... CTD PMID:32135237 Ddah2 Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of DDAH2 mRNA CTD PMID:34492290 Ddah2 Rat titanium dioxide decreases methylation ISO Ddah2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DDAH2 gene CTD PMID:35295148 Ddah2 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of DDAH2 mRNA CTD PMID:22967744 Ddah2 Rat trichostatin A decreases expression ISO DDAH2 (Homo sapiens) 6480464 trichostatin A results in decreased expression of DDAH2 mRNA CTD PMID:24935251 and PMID:26272509 Ddah2 Rat trichostatin A multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DDAH2 mRNA CTD PMID:27188386 Ddah2 Rat trimellitic anhydride increases expression ISO Ddah2 (Mus musculus) 6480464 trimellitic anhydride results in increased expression of DDAH2 mRNA CTD PMID:16141432 Ddah2 Rat triphenyl phosphate affects expression ISO DDAH2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DDAH2 mRNA CTD PMID:37042841 Ddah2 Rat triptonide decreases expression ISO Ddah2 (Mus musculus) 6480464 triptonide results in decreased expression of DDAH2 mRNA CTD PMID:33045310 Ddah2 Rat Tungsten carbide multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [tungsten carbide co-treated with Cobalt] results in decreased expression of DDAH2 mRNA CTD PMID:18078969 Ddah2 Rat valproic acid affects expression ISO DDAH2 (Homo sapiens) 6480464 Valproic Acid affects the expression of DDAH2 mRNA CTD PMID:25979313 Ddah2 Rat valproic acid decreases expression ISO DDAH2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DDAH2 mRNA CTD PMID:23179753 more ... Ddah2 Rat valproic acid multiple interactions ISO DDAH2 (Homo sapiens) 6480464 [NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression of DDAH2 mRNA CTD PMID:27188386 Ddah2 Rat vancomycin decreases expression ISO Ddah2 (Mus musculus) 6480464 Vancomycin results in decreased expression of DDAH2 mRNA CTD PMID:18930951 Ddah2 Rat vitamin E increases expression ISO DDAH2 (Homo sapiens) 6480464 Vitamin E results in increased expression of DDAH2 mRNA CTD PMID:19244175 Ddah2 Rat vorinostat decreases expression ISO DDAH2 (Homo sapiens) 6480464 vorinostat results in decreased expression of DDAH2 mRNA CTD PMID:27188386
1,2-dimethylhydrazine (ISO) 17alpha-ethynylestradiol (EXP,ISO) 17beta-estradiol (ISO) 17beta-estradiol 3-benzoate (EXP) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2-hydroxypropanoic acid (ISO) 3,3',5,5'-tetrabromobisphenol A (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxyphenyl retinamide (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) acetamide (EXP) actinomycin D (ISO) all-trans-retinoic acid (EXP,ISO) amphetamine (EXP) antirheumatic drug (ISO) aristolochic acid A (ISO) benzo[a]pyrene (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) bisphenol F (ISO) cadmium dichloride (ISO) carbon nanotube (ISO) chlorpyrifos (ISO) cisplatin (ISO) cobalt atom (ISO) cobalt dichloride (EXP,ISO) copper(II) sulfate (ISO) coumestrol (ISO) cyclosporin A (ISO) dibutyl phthalate (EXP) dioxygen (EXP) diuron (EXP) dorsomorphin (ISO) doxorubicin (ISO) elemental selenium (ISO) endosulfan (EXP) Enterolactone (ISO) entinostat (ISO) formaldehyde (ISO) fulvestrant (ISO) furan (EXP) genistein (ISO) heparin (EXP) indole-3-methanol (EXP) iron dextran (ISO) ivermectin (ISO) L-arginine (ISO) lead(II) chloride (ISO) lidocaine (EXP) malonaldehyde (ISO) melatonin (EXP) methotrexate (EXP) morphine (EXP) N(omega),N(omega)-dimethyl-L-arginine (ISO) nebivolol (ISO) nickel sulfate (ISO) niclosamide (ISO) nitric oxide (ISO) ozone (ISO) paracetamol (EXP,ISO) paraquat (EXP) progesterone (ISO) rac-lactic acid (ISO) reactive oxygen species (ISO) resveratrol (ISO) SB 431542 (ISO) selenium atom (ISO) sodium arsenite (ISO) Soman (EXP) sulforaphane (ISO) sunitinib (ISO) tamoxifen (ISO) tetramethylpyrazine (ISO) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) trichostatin A (ISO) trimellitic anhydride (ISO) triphenyl phosphate (ISO) triptonide (ISO) Tungsten carbide (ISO) valproic acid (ISO) vancomycin (ISO) vitamin E (ISO) vorinostat (ISO)
Ddah2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 20 3,766,115 - 3,769,161 (-) NCBI GRCr8 mRatBN7.2 20 3,761,460 - 3,764,718 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 20 3,761,465 - 3,764,511 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 20 4,460,950 - 4,463,996 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 20 3,823,004 - 3,826,050 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 20 4,360,895 - 4,363,941 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 20 5,049,260 - 5,052,573 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 20 5,049,496 - 5,052,585 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 20 7,122,457 - 7,125,503 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 20 3,829,767 - 3,836,141 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 20 3,829,994 - 3,831,997 (-) NCBI Celera 20 4,261,560 - 4,264,603 (+) NCBI Celera Cytogenetic Map 20 p12 NCBI
DDAH2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 31,727,040 - 31,730,263 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 31,727,038 - 31,730,617 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 31,694,817 - 31,698,040 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 31,802,796 - 31,806,018 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 31,802,796 - 31,806,018 NCBI Celera 6 33,293,042 - 33,296,264 (-) NCBI Celera Cytogenetic Map 6 p21.33 NCBI HuRef 6 31,481,041 - 31,484,263 (-) NCBI HuRef CHM1_1 6 31,696,934 - 31,700,156 (-) NCBI CHM1_1 T2T-CHM13v2.0 6 31,580,073 - 31,583,296 (-) NCBI T2T-CHM13v2.0
Ddah2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 17 35,278,011 - 35,281,075 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 17 35,278,011 - 35,281,071 (+) Ensembl GRCm39 Ensembl GRCm38 17 35,059,035 - 35,062,099 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 17 35,059,035 - 35,062,095 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 17 35,195,980 - 35,199,044 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 17 34,667,157 - 34,670,151 (+) NCBI MGSCv36 mm8 Celera 17 38,155,720 - 38,158,784 (+) NCBI Celera Cytogenetic Map 17 B1 NCBI cM Map 17 18.59 NCBI
Ddah2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955437 260,969 - 269,660 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955437 265,727 - 269,016 (-) NCBI ChiLan1.0 ChiLan1.0
DDAH2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 46,204,269 - 46,207,547 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 42,165,770 - 42,169,008 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 31,388,401 - 31,391,637 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 32,277,102 - 32,280,336 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 32,277,102 - 32,280,338 (-) Ensembl panpan1.1 panPan2
DDAH2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 1,206,180 - 1,209,459 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 1,206,309 - 1,208,389 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 1,342,719 - 1,346,021 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 1,351,545 - 1,354,847 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 12 1,351,552 - 1,354,808 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 12 1,210,814 - 1,214,096 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 1,278,042 - 1,281,342 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 1,345,682 - 1,348,984 (-) NCBI UU_Cfam_GSD_1.0
Ddah2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 35,753,903 - 35,757,640 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936727 1,804,455 - 1,807,183 (+) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936727 1,803,711 - 1,807,441 (+) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DDAH2
DDAH2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 40,292,674 - 40,295,917 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 40,292,707 - 40,295,712 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 31,640,050 - 31,643,297 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Ddah2
.
Predicted Target Of
Count of predictions: 173 Count of miRNA genes: 128 Interacting mature miRNAs: 136 Transcripts: ENSRNOT00000001118 Prediction methods: Microtar, Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
61472 Aia1 Adjuvant induced arthritis QTL 1 18 0.001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 2646395 4597031 Rat 2306850 Pia40 Pristane induced arthritis QTL 40 0.0001 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 1527959 5304575 Rat 1641915 Colcr9 Colorectal carcinoma resistance QTL 9 2.97 0.0024 intestine integrity trait (VT:0010554) benign colorectal tumor number (CMO:0001795) 20 1530655 46530655 Rat 2317057 Aia27 Adjuvant induced arthritis QTL 27 2.83 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 20 2892597 26381954 Rat 7387283 Uae44 Urinary albumin excretion QTL 44 0.1712 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 20 1 26123605 Rat 7411668 Foco32 Food consumption QTL 32 8 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 36600972 Rat 2305926 Iddm37 Insulin dependent diabetes mellitus QTL 37 6 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 20 1527842 46527842 Rat 1354642 Despr15 Despair related QTL 15 0.0027 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 20 1 24159021 Rat 1600382 Edcs3 Endometrial carcinoma susceptibility QTL3 3.5 0.003 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 20 1 25159026 Rat 61448 Ciaa1 CIA Autoantibody QTL 1 30 0.001 blood autoantibody amount (VT:0003725) calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281) 20 2646395 4597031 Rat 1331772 Cdexp2 CD45RC expression in CD8 T cells QTL 2 5.7 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 20 3621649 10078919 Rat 8694189 Bw153 Body weight QTL 153 3.13 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 20 1 29191651 Rat 1300152 Bp195 Blood pressure QTL 195 3.46 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 20 3621649 9243559 Rat 9590109 Sffal8 Serum free fatty acids level QTL 8 5.32 0.01 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 20 1 29191651 Rat 9590275 Scort15 Serum corticosterone level QTL 15 3.48 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 29191651 Rat 9589155 Insul32 Insulin level QTL 32 6.38 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 20 1 29191651 Rat 7411650 Foco23 Food consumption QTL 23 20.7 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 20 1 29191651 Rat 2317851 Alcrsp22 Alcohol response QTL 22 3.2 0.05 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 1598816 Memor12 Memory QTL 12 2.4 exploratory behavior trait (VT:0010471) average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674) 20 2606836 47606836 Rat 61432 Cia1 Collagen induced arthritis QTL 1 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 14101050 Rat 1641893 Alcrsp7 Alcohol response QTL 7 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 20 1 27339237 Rat 6893685 Bw111 Body weight QTL 111 2.7 0.004 body mass (VT:0001259) body weight (CMO:0000012) 20 1 32578807 Rat 9590252 Scort12 Serum corticosterone level QTL 12 20.46 0.001 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 20 1 36600972 Rat 737973 Pia21 Pristane induced arthritis QTL 21 4.8 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 20 3621656 4606812 Rat
RH128085
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 3,761,504 - 3,761,717 (-) MAPPER mRatBN7.2 Rnor_6.0 20 5,052,316 - 5,052,528 NCBI Rnor6.0 Rnor_5.0 20 7,125,246 - 7,125,458 UniSTS Rnor5.0 RGSC_v3.4 20 3,829,812 - 3,830,024 UniSTS RGSC3.4 Celera 20 4,264,346 - 4,264,558 UniSTS RH 3.4 Map 20 49.3 UniSTS Cytogenetic Map 20 p12 UniSTS
Clic1
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 20 3,765,025 - 3,765,180 (-) MAPPER mRatBN7.2 Rnor_6.0 20 5,048,853 - 5,049,007 NCBI Rnor6.0 Rnor_5.0 20 7,121,783 - 7,121,937 UniSTS Rnor5.0 RGSC_v3.4 20 3,499,094 - 3,499,248 UniSTS RGSC3.4 Celera 20 4,260,886 - 4,261,040 UniSTS Cytogenetic Map 20 p12 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000001118 ⟹ ENSRNOP00000001118
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 5,049,505 - 5,052,572 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000083353 ⟹ ENSRNOP00000068864
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl 20 5,050,327 - 5,052,572 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000088251 ⟹ ENSRNOP00000069121
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 20 3,761,465 - 3,764,511 (-) Ensembl Rnor_6.0 Ensembl 20 5,049,496 - 5,052,585 (+) Ensembl
RefSeq Acc Id:
NM_001165936 ⟹ NP_001159408
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,766,115 - 3,768,413 (-) NCBI mRatBN7.2 20 3,761,460 - 3,763,758 (-) NCBI Rnor_6.0 20 5,050,275 - 5,052,573 (+) NCBI Rnor_5.0 20 7,122,457 - 7,125,503 (+) NCBI RGSC_v3.4 20 3,829,767 - 3,836,141 (-) RGD Celera 20 4,262,308 - 4,264,603 (+) NCBI
Sequence:
GGGAAGGGACCTAGCGGAGCCCCGAGCAGGGGCAACAGGTGTTTGGGAGATTAAGGACCCAAGTCTTGTTCCCTTGGGCGCCTCTTAACGCAGATCCCCGGTGAAAGGAGGCTGAGCGGGGTCCACGG
hide sequence
RefSeq Acc Id:
NM_212532 ⟹ NP_997697
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,766,115 - 3,769,161 (-) NCBI mRatBN7.2 20 3,761,460 - 3,764,506 (-) NCBI Rnor_6.0 20 5,049,527 - 5,052,573 (+) NCBI Rnor_5.0 20 7,122,457 - 7,125,503 (+) NCBI RGSC_v3.4 20 3,829,767 - 3,836,141 (-) RGD Celera 20 4,261,560 - 4,264,603 (+) RGD
Sequence:
GCCAGACCATCGCGCCCCCGCCCCATCGCCGTACGTGAGCTCGCCTACCCTGGGAACCCCTCAAAAGCCCGAGCTATCGGTCTCTCCTGCTTGAAGACTCAAGCTCCCATCTTCATCAACTCTCTCCT
hide sequence
RefSeq Acc Id:
XM_008772715 ⟹ XP_008770937
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,766,116 - 3,768,075 (-) NCBI mRatBN7.2 20 3,761,461 - 3,764,718 (-) NCBI Rnor_6.0 20 5,049,260 - 5,052,572 (+) NCBI
Sequence:
GGAATTAAGGAGGGGACTGTTTGTACAGGGTCTGCCATGTTTTGCATCTGTCCGTTAGAGGGTT
hide sequence
RefSeq Acc Id:
XM_063279000 ⟹ XP_063135070
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 20 3,766,116 - 3,768,075 (-) NCBI
RefSeq Acc Id:
NP_997697 ⟸ NM_212532
- UniProtKB:
Q6MG60 (UniProtKB/Swiss-Prot), A6KTR6 (UniProtKB/TrEMBL)
- Sequence:
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEMGDENATLDGTD
hide sequence
RefSeq Acc Id:
NP_001159408 ⟸ NM_001165936
- UniProtKB:
Q6MG60 (UniProtKB/Swiss-Prot), A6KTR6 (UniProtKB/TrEMBL)
- Sequence:
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELP
hide sequence
RefSeq Acc Id:
XP_008770937 ⟸ XM_008772715
- Peptide Label:
isoform X2
- Sequence:
MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGGKLRQRLGLQLLELPPEESLPLGPLLGDTAVIQGDTALITRPWSPARRPEVDGVRKALQDLGLRIVEMGDENATLDGTD
hide sequence
Ensembl Acc Id:
ENSRNOP00000068864 ⟸ ENSRNOT00000083353
Ensembl Acc Id:
ENSRNOP00000069121 ⟸ ENSRNOT00000088251
Ensembl Acc Id:
ENSRNOP00000001118 ⟸ ENSRNOT00000001118
RefSeq Acc Id:
XP_063135070 ⟸ XM_063279000
- Peptide Label:
isoform X1
- UniProtKB:
A6KTR7 (UniProtKB/TrEMBL)
RGD ID: 13701386 Promoter ID: EPDNEW_R11910 Type: initiation region Name: Ddah2_1 Description: dimethylarginine dimethylaminohydrolase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11911 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 5,049,509 - 5,049,569 EPDNEW
RGD ID: 13701387 Promoter ID: EPDNEW_R11911 Type: multiple initiation site Name: Ddah2_2 Description: dimethylarginine dimethylaminohydrolase 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Alternative Promoters: null; see alsoEPDNEW_R11910 Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 20 5,050,251 - 5,050,311 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2023-08-03
Ddah2
DDAH family member 2, ADMA-independent
Ddah2
dimethylarginine dimethylaminohydrolase 2
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-03-30
Ddah2
dimethylarginine dimethylaminohydrolase 2
Symbol and Name status set to approved
1299863 APPROVED
2005-02-14
Ddah2
dimethylarginine dimethylaminohydrolase 2
Symbol and Name status set to provisional
70820 PROVISIONAL
