Symbol:
Il17a
Name:
interleukin 17A
RGD ID:
2888
Description:
Predicted to enable cytokine activity; protein heterodimerization activity; and protein homodimerization activity. Involved in cellular response to glucocorticoid stimulus; positive regulation of transcription by RNA polymerase II; and response to amino acid. Located in extracellular space. Used to study anti-basement membrane glomerulonephritis; congestive heart failure; myocarditis; pleurisy; and uveitis. Biomarker of several diseases, including acute necrotizing pancreatitis; inflammatory bowel disease (multiple); lung disease (multiple); myocardial infarction (multiple); and periodontal disease (multiple). Human ortholog(s) of this gene implicated in Mycobacterium avium complex disease; autoimmune disease (multiple); bronchial disease (multiple); macular degeneration; and rhinitis (multiple). Orthologous to human IL17A (interleukin 17A); PARTICIPATES IN interleukin-23 signaling pathway; interleukin-27 signaling pathway; INTERACTS WITH 1-chloro-2,4-dinitrobenzene; 2,4,6-trinitrobenzenesulfonic acid; 7,12-dimethyltetraphene.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CTLA-8; cytotoxic T-lymphocyte-associated antigen 8; hypothetical protein LOC301289; IL-17; IL-17A; Il17; interleukin 17; Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8); interleukin-17A; LOC301289; similar to Interleukin-17 precursor (IL-17) (Cytotoxic T lymphocyte-associated antigen 8) (CTLA-8)
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Species
Gene symbol and name
Data Source
Assertion derived from
less info ...
Orthologs 1
Homo sapiens (human):
IL17A (interleukin 17A) HGNC
EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):
Il17a (interleukin 17A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):
Il17a (interleukin 17A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):
IL17A (interleukin 17A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Canis lupus familiaris (dog):
IL17A (interleukin 17A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):
Il17a (interleukin 17A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Sus scrofa (pig):
IL17A (interleukin 17A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):
IL17A (interleukin 17A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):
Il17a (interleukin 17A) Transitive Ortholog Pipeline
Transitive Ortholog Pipeline
Other homologs 2
Homo sapiens (human):
IL17F (interleukin 17F) HGNC
OrthoDB
Alliance orthologs 3
Mus musculus (house mouse):
Il17a (interleukin 17A)
Alliance
DIOPT (Ensembl Compara|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Homo sapiens (human):
IL17A (interleukin 17A)
Alliance
DIOPT (Ensembl Compara|HGNC|Hieranoid|InParanoid|OMA|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
il17a/f2 (interleukin 17a/f2)
Alliance
DIOPT (InParanoid|OrthoFinder|OrthoInspector)
Danio rerio (zebrafish):
il17a/f3 (interleukin 17a/f3)
Alliance
DIOPT (Hieranoid|OrthoFinder|OrthoInspector|PhylomeDB|SonicParanoid)
Danio rerio (zebrafish):
il17a/f1 (interleukin 17a/f1)
Alliance
DIOPT (OrthoFinder|OrthoInspector|PhylomeDB)
Caenorhabditis elegans (roundworm):
F25D1.3
Alliance
DIOPT (Ensembl Compara|OrthoFinder)
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 30,640,844 - 30,644,331 (+) NCBI GRCr8 mRatBN7.2 9 23,144,402 - 23,147,889 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 23,144,402 - 23,147,889 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 31,641,574 - 31,645,060 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 36,762,293 - 36,765,779 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 35,077,566 - 35,081,052 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 26,841,299 - 26,844,786 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 26,841,299 - 26,844,786 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 25,696,865 - 25,700,352 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 19,454,979 - 19,458,467 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 19,453,469 - 19,455,797 (+) NCBI Celera 9 20,720,899 - 20,724,386 (+) NCBI Celera Cytogenetic Map 9 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Il17a Rat (+)-Tetrandrine multiple interactions ISO Il17a (Mus musculus) 6480464 resveratrol inhibits the reaction [tetrandrine inhibits the reaction [COL2A1 protein results in increased expression of IL17A protein]] and tetrandrine inhibits the reaction [COL2A1 protein results in increased expression of IL17A protein] CTD PMID:26640276 Il17a Rat (+)-Tetrandrine decreases expression ISO Il17a (Mus musculus) 6480464 tetrandrine results in decreased expression of IL17A mRNA CTD PMID:26640276 Il17a Rat (R,R,R)-alpha-tocopherol multiple interactions ISO Il17a (Mus musculus) 6480464 alpha-Tocopherol inhibits the reaction [Ozone promotes the reaction [Ovalbumin results in increased expression of IL17A mRNA]] CTD PMID:29284473 Il17a Rat (S)-nicotine multiple interactions ISO IL17A (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with Nicotine] results in increased expression of IL17A mRNA more ... CTD PMID:23199342 Il17a Rat (Z)-ligustilide multiple interactions ISO Il17a (Mus musculus) 6480464 ligustilide inhibits the reaction [Dextran Sulfate results in increased expression of IL17A mRNA] CTD PMID:33130971 Il17a Rat 1-(4'-hydroxy-3'-methoxyphenyl)-7-phenyl-3-heptanone multiple interactions ISO Il17a (Mus musculus) 6480464 yakuchinone-A inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of and results in increased secretion of IL17A protein] CTD PMID:31001353 Il17a Rat 1-chloro-2,4-dinitrobenzene multiple interactions ISO Il17a (Mus musculus) 6480464 [Antigens more ... CTD PMID:23133493 and PMID:23499868 Il17a Rat 1-chloro-2,4-dinitrobenzene increases expression EXP 6480464 Dinitrochlorobenzene results in increased expression of IL17A mRNA CTD PMID:25449201 Il17a Rat 1-chloro-2,4-dinitrobenzene increases expression ISO Il17a (Mus musculus) 6480464 Dinitrochlorobenzene results in increased expression of IL17A mRNA CTD PMID:23133493 Il17a Rat 1-fluoro-2,4-dinitrobenzene increases expression ISO Il17a (Mus musculus) 6480464 Dinitrofluorobenzene results in increased expression of IL17A mRNA CTD PMID:23499868 Il17a Rat 1-fluoro-2,4-dinitrobenzene multiple interactions ISO Il17a (Mus musculus) 6480464 oleanolic acid 3-acetate inhibits the reaction [Dinitrofluorobenzene results in increased expression of IL17A mRNA] CTD PMID:23499868 Il17a Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine increases expression ISO Il17a (Mus musculus) 6480464 1-Methyl-4-phenyl-1 more ... CTD PMID:31351185 Il17a Rat 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine multiple interactions ISO Il17a (Mus musculus) 6480464 IL17A protein promotes the reaction [1-Methyl-4-phenyl-1 more ... CTD PMID:31351185 Il17a Rat 1-naphthyl isothiocyanate increases expression ISO Il17a (Mus musculus) 6480464 1-Naphthylisothiocyanate results in increased expression of IL17A protein CTD PMID:20594950 Il17a Rat 17alpha-ethynylestradiol multiple interactions ISO Il17a (Mus musculus) 6480464 [Ethinyl Estradiol co-treated with IL17A protein] results in increased secretion of ALPL protein more ... CTD PMID:36329302 Il17a Rat 17alpha-ethynylestradiol increases expression ISO Il17a (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of IL17A mRNA and Ethinyl Estradiol results in increased expression of IL17A protein CTD PMID:36329302 Il17a Rat 17beta-estradiol multiple interactions ISO Il17a (Mus musculus) 6480464 Estradiol inhibits the reaction [Halothane results in increased expression of IL17A protein] and fulvestrant inhibits the reaction [Estradiol inhibits the reaction [Halothane results in increased expression of IL17A protein]] CTD PMID:21501669 Il17a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Il17a (Mus musculus) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in increased secretion of IL17A protein] more ... CTD PMID:21804081 more ... Il17a Rat 2,3,7,8-tetrachlorodibenzodioxine increases secretion ISO Il17a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased secretion of IL17A protein CTD PMID:32911021 Il17a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Il17a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of IL17A protein CTD PMID:25716673 Il17a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Il17a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of IL17A mRNA CTD PMID:21131560 Il17a Rat 2,4,6-trinitrobenzenesulfonic acid increases expression EXP 6480464 Trinitrobenzenesulfonic Acid results in increased expression of IL17A protein CTD PMID:31428839 Il17a Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions ISO IL17A (Homo sapiens) 6480464 [Trinitrobenzenesulfonic Acid results in increased susceptibility to [Ionomycin co-treated with Tetradecanoylphorbol Acetate]] which results in increased expression of IL17A protein CTD PMID:27783946 Il17a Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO IL17A (Homo sapiens) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of IL17A mRNA CTD PMID:27783946 Il17a Rat 2,4,6-trinitrobenzenesulfonic acid multiple interactions EXP 6480464 Methylene Blue inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of IL17A protein] and Sulfasalazine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of IL17A protein] CTD PMID:31428839 Il17a Rat 2,4,6-trinitrobenzenesulfonic acid increases expression ISO Il17a (Mus musculus) 6480464 Trinitrobenzenesulfonic Acid results in increased expression of IL17A mRNA and Trinitrobenzenesulfonic Acid results in increased expression of IL17A protein CTD PMID:17375199 and PMID:23027085 Il17a Rat 2,4-dibromophenyl 2,4,5-tribromophenyl ether affects expression ISO Il17a (Mus musculus) 6480464 2 more ... CTD PMID:38648751 Il17a Rat 3,3',5-triiodo-L-thyronine multiple interactions ISO IL17A (Homo sapiens) 6480464 [Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA and Rosmarinic Acid inhibits the reaction [[Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA] CTD PMID:33476690 Il17a Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine increases expression ISO Il17a (Mus musculus) 6480464 3 more ... CTD PMID:30825315 Il17a Rat 3,5-diethoxycarbonyl-1,4-dihydrocollidine multiple interactions ISO Il17a (Mus musculus) 6480464 NFE2L2 gene mutant form promotes the reaction [3 more ... CTD PMID:30825315 Il17a Rat 3-acetyldeoxynivalenol increases expression ISO Il17a (Mus musculus) 6480464 3-acetyldeoxynivalenol results in increased expression of IL17A mRNA CTD PMID:35413383 Il17a Rat 3-acetyldeoxynivalenol multiple interactions ISO Il17a (Mus musculus) 6480464 3-acetyldeoxynivalenol results in increased expression of and results in increased secretion of IL17A protein more ... CTD PMID:35413383 Il17a Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO IL17A (Homo sapiens) 6480464 [Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA and Rosmarinic Acid inhibits the reaction [[Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA] CTD PMID:33476690 Il17a Rat 4,4'-sulfonyldiphenol increases secretion ISO Il17a (Mus musculus) 6480464 bisphenol S results in increased secretion of IL17A protein CTD PMID:32911021 Il17a Rat 4,4'-sulfonyldiphenol increases expression ISO IL17A (Homo sapiens) 6480464 bisphenol S results in increased expression of IL17A mRNA CTD PMID:34979203 Il17a Rat 4-hydroxy-TEMPO multiple interactions ISO Il17a (Mus musculus) 6480464 tempol inhibits the reaction [Tobacco Smoke Pollution results in increased expression of IL17A mRNA] CTD PMID:32726580 Il17a Rat 4-hydroxynon-2-enal decreases expression ISO IL17A (Homo sapiens) 6480464 4-hydroxy-2-nonenal results in decreased expression of IL17A mRNA CTD PMID:12419474 Il17a Rat 4-phenylbutyric acid multiple interactions ISO Il17a (Mus musculus) 6480464 4-phenylbutyric acid inhibits the reaction [3-acetyldeoxynivalenol results in increased expression of and results in increased secretion of IL17A protein] and 4-phenylbutyric acid inhibits the reaction [3-acetyldeoxynivalenol results in increased expression of IL17A mRNA] CTD PMID:35413383 Il17a Rat 5-aza-2'-deoxycytidine multiple interactions ISO IL17A (Homo sapiens) 6480464 [[Decitabine co-treated with TGFB1 protein] results in increased expression of FOXP3 protein] which results in increased expression of IL17A protein CTD PMID:18567616 Il17a Rat 6-O-alpha-D-glucopyranosyl-D-fructofuranose multiple interactions ISO Il17a (Mus musculus) 6480464 isomaltulose inhibits the reaction [Dextran Sulfate results in increased expression of IL17A mRNA] CTD PMID:35894244 Il17a Rat 7,12-dimethyltetraphene increases expression EXP 6480464 9 more ... CTD PMID:33063951 Il17a Rat 7,12-dimethyltetraphene multiple interactions EXP 6480464 Vitamin K inhibits the reaction [9 more ... CTD PMID:33063951 Il17a Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione multiple interactions EXP 6480464 IL17A protein affects the reaction [Uric Acid results in increased expression of ACTA2 mRNA] more ... CTD PMID:37815028 Il17a Rat 7,9-dihydro-1H-purine-2,6,8(3H)-trione increases expression EXP 6480464 Uric Acid results in increased expression of IL17A protein CTD PMID:37815028 Il17a Rat acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester multiple interactions ISO Il17a (Mus musculus) 6480464 nitazoxanide inhibits the reaction [Dextran Sulfate results in increased expression of IL17A mRNA] CTD PMID:38663798 Il17a Rat acetylsalicylic acid affects response to substance ISO IL17A (Homo sapiens) 6480464 IL17A polymorphism affects the susceptibility to Aspirin CTD PMID:22123380 Il17a Rat actinomycin D multiple interactions ISO Il17a (Mus musculus) 6480464 Dactinomycin inhibits the reaction [Glucose results in increased secretion of IL17A protein] CTD PMID:18310510 Il17a Rat aflatoxin B1 increases expression ISO Il17a (Mus musculus) 6480464 Aflatoxin B1 results in increased expression of IL17A mRNA CTD PMID:19770486 Il17a Rat aldehydo-D-glucose multiple interactions ISO Il17a (Mus musculus) 6480464 Cycloheximide inhibits the reaction [Glucose results in increased secretion of IL17A protein] more ... CTD PMID:18310510 Il17a Rat aldehydo-D-glucose increases expression ISO Il17a (Mus musculus) 6480464 Glucose results in increased expression of IL17A mRNA CTD PMID:18310510 Il17a Rat aldehydo-D-glucose increases secretion ISO Il17a (Mus musculus) 6480464 Glucose results in increased secretion of IL17A protein CTD PMID:18310510 Il17a Rat alloxan multiple interactions ISO Il17a (Mus musculus) 6480464 Alloxan results in increased expression of and results in increased secretion of IL17A protein and platycodin D inhibits the reaction [Alloxan results in increased expression of and results in increased secretion of IL17A protein] CTD PMID:25887267 Il17a Rat alpha-amanitin affects expression ISO Il17a (Mus musculus) 6480464 Alpha-Amanitin affects the expression of IL17A mRNA CTD PMID:38531469 Il17a Rat alpha-galactosylceramide multiple interactions ISO Il17a (Mus musculus) 6480464 [Ovalbumin co-treated with alpha-galactosylceramide] results in decreased secretion of IL17A protein CTD PMID:30803854 Il17a Rat alpha-hexylcinnamaldehyde increases expression ISO Il17a (Mus musculus) 6480464 hexyl cinnamic aldehyde results in increased expression of IL17A mRNA and hexyl cinnamic aldehyde results in increased expression of IL17A protein CTD PMID:28826779 Il17a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of IL17A mRNA CTD PMID:16483693 Il17a Rat amphibole asbestos increases expression ISO Il17a (Mus musculus) 6480464 Asbestos and Amphibole results in increased expression of IL17A protein CTD PMID:28870655 Il17a Rat anthra[1,9-cd]pyrazol-6(2H)-one multiple interactions EXP 6480464 pyrazolanthrone inhibits the reaction [[Iodine co-treated with Dibutyl Phthalate] results in increased expression of IL17A protein] CTD PMID:29385629 Il17a Rat antigen multiple interactions ISO Il17a (Mus musculus) 6480464 [deoxynivalenol results in increased susceptibility to Antigens] which results in increased expression of IL17A protein and [ochratoxin A results in increased susceptibility to Antigens] which results in increased expression of IL17A protein CTD PMID:28935500 Il17a Rat antigen increases expression ISO Il17a (Mus musculus) 6480464 Antigens results in increased expression of IL17A protein CTD PMID:27038180 Il17a Rat apilimod decreases expression ISO IL17A (Homo sapiens) 6480464 apilimod results in decreased expression of IL17A mRNA CTD PMID:21348542 Il17a Rat arsane multiple interactions ISO IL17A (Homo sapiens) 6480464 [Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of IL17A mRNA and Arsenic results in decreased secretion of and results in decreased expression of IL17A protein CTD PMID:22617429 and PMID:28793237 Il17a Rat arsane increases expression ISO IL17A (Homo sapiens) 6480464 Arsenic results in increased expression of IL17A gene and Arsenic results in increased expression of IL17A protein CTD PMID:35363433 Il17a Rat arsane affects expression ISO IL17A (Homo sapiens) 6480464 Arsenic affects the expression of IL17A mRNA CTD PMID:28793237 Il17a Rat arsane increases expression ISO Il17a (Mus musculus) 6480464 Arsenic results in increased expression of IL17A protein CTD PMID:27289040 Il17a Rat arsenic atom multiple interactions ISO IL17A (Homo sapiens) 6480464 [Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of IL17A mRNA and Arsenic results in decreased secretion of and results in decreased expression of IL17A protein CTD PMID:22617429 and PMID:28793237 Il17a Rat arsenic atom increases expression ISO IL17A (Homo sapiens) 6480464 Arsenic results in increased expression of IL17A gene and Arsenic results in increased expression of IL17A protein CTD PMID:35363433 Il17a Rat arsenic atom affects expression ISO IL17A (Homo sapiens) 6480464 Arsenic affects the expression of IL17A mRNA CTD PMID:28793237 Il17a Rat arsenic atom increases expression ISO Il17a (Mus musculus) 6480464 Arsenic results in increased expression of IL17A protein CTD PMID:27289040 Il17a Rat arsenous acid decreases expression ISO IL17A (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of IL17A mRNA and Arsenic Trioxide results in decreased expression of IL17A protein CTD PMID:29950232 and PMID:34108876 Il17a Rat arsenous acid decreases secretion ISO IL17A (Homo sapiens) 6480464 Arsenic Trioxide results in decreased secretion of IL17A protein CTD PMID:34108876 Il17a Rat asbestos increases expression ISO IL17A (Homo sapiens) 6480464 Asbestos results in increased expression of IL17A protein CTD PMID:25162674 Il17a Rat Azoxymethane increases expression ISO Il17a (Mus musculus) 6480464 Azoxymethane results in increased expression of IL17A protein CTD PMID:20431929 Il17a Rat Azoxymethane multiple interactions ISO Il17a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IL17A mRNA and Acetylcysteine inhibits the reaction [Azoxymethane results in increased expression of IL17A protein] CTD PMID:20431929 and PMID:29950665 Il17a Rat Bardoxolone methyl multiple interactions ISO Il17a (Mus musculus) 6480464 bardoxolone methyl inhibits the reaction [Lipopolysaccharides results in increased expression of and results in increased secretion of IL17A protein] CTD PMID:26918785 Il17a Rat benzene decreases expression ISO Il17a (Mus musculus) 6480464 Benzene results in decreased expression of IL17A protein CTD PMID:34673135 Il17a Rat benzo[a]pyrene increases methylation ISO IL17A (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of IL17A promoter CTD PMID:27901495 Il17a Rat benzo[a]pyrene increases expression EXP 6480464 Benzo(a)pyrene results in increased expression of IL17A mRNA CTD PMID:34999049 Il17a Rat benzo[a]pyrene multiple interactions EXP 6480464 [IL27 protein co-treated with IFNL3 protein] inhibits the reaction [Benzo(a)pyrene results in increased expression of IL17A mRNA] CTD PMID:34999049 Il17a Rat benzo[a]pyrene multiple interactions ISO Il17a (Mus musculus) 6480464 Benzo(a)pyrene inhibits the reaction [Dextran Sulfate results in increased expression of IL17A mRNA] CTD PMID:34998820 Il17a Rat beta-naphthoflavone multiple interactions ISO Il17a (Mus musculus) 6480464 beta-Naphthoflavone promotes the reaction [Plant Extracts results in increased expression of IL17A protein] CTD PMID:22491429 Il17a Rat biochanin A multiple interactions ISO Il17a (Mus musculus) 6480464 biochanin A promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] CTD PMID:25583575 Il17a Rat bis(2-ethylhexyl) phthalate decreases expression ISO Il17a (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of IL17A mRNA CTD PMID:34319233 and PMID:36209858 Il17a Rat bis(2-ethylhexyl) phthalate increases expression ISO Il17a (Mus musculus) 6480464 Diethylhexyl Phthalate results in increased expression of IL17A mRNA and Diethylhexyl Phthalate results in increased expression of IL17A protein CTD PMID:33497755 Il17a Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of IL17A mRNA CTD PMID:25181051 Il17a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of IL17A protein CTD PMID:31661889 Il17a Rat bisphenol A multiple interactions EXP 6480464 Fructose promotes the reaction [bisphenol A results in increased expression of IL17A protein] CTD PMID:31661889 Il17a Rat bisphenol A increases secretion ISO Il17a (Mus musculus) 6480464 bisphenol A results in increased secretion of IL17A protein CTD PMID:32702508 Il17a Rat bisphenol A multiple interactions ISO Il17a (Mus musculus) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [bisphenol A affects the secretion of IL17A protein] and Cholecalciferol inhibits the reaction [bisphenol A results in increased secretion of IL17A protein] CTD PMID:32702508 and PMID:32911021 Il17a Rat bisphenol A increases expression ISO Il17a (Mus musculus) 6480464 bisphenol A results in increased expression of IL17A mRNA and bisphenol A results in increased expression of IL17A protein CTD PMID:27693988 more ... Il17a Rat bisphenol A affects secretion ISO Il17a (Mus musculus) 6480464 bisphenol A affects the secretion of IL17A protein CTD PMID:32911021 Il17a Rat bisphenol A decreases secretion ISO IL17A (Homo sapiens) 6480464 bisphenol A results in decreased secretion of IL17A protein CTD PMID:32911021 Il17a Rat bisphenol F multiple interactions ISO Il17a (Mus musculus) 6480464 2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [4 and 4'-bisphenol F results in increased secretion of IL17A protein] CTD PMID:32911021 Il17a Rat bisphenol F multiple interactions ISO IL17A (Homo sapiens) 6480464 [bisphenol F co-treated with Lipopolysaccharides] results in increased expression of IL17A mRNA CTD PMID:34774955 Il17a Rat bisphenol F increases secretion ISO Il17a (Mus musculus) 6480464 4 and 4'-bisphenol F results in increased secretion of IL17A protein CTD PMID:32911021 Il17a Rat bleomycin A2 increases expression ISO Il17a (Mus musculus) 6480464 Bleomycin results in increased expression of IL17A mRNA CTD PMID:35716765 Il17a Rat bleomycin A2 multiple interactions ISO Il17a (Mus musculus) 6480464 Curcumin inhibits the reaction [Bleomycin results in increased expression of IL17A mRNA] CTD PMID:35716765 Il17a Rat budesonide multiple interactions ISO Il17a (Mus musculus) 6480464 Budesonide inhibits the reaction [Ozone results in increased expression of IL17A protein] and Progesterone promotes the reaction [Budesonide inhibits the reaction [Ozone results in increased expression of IL17A protein]] CTD PMID:28279894 Il17a Rat Butylbenzyl phthalate increases expression ISO Il17a (Mus musculus) 6480464 butylbenzyl phthalate results in increased expression of IL17A protein CTD PMID:32308655 Il17a Rat cadmium atom affects expression EXP 6480464 Cadmium affects the expression of IL17A CTD PMID:26051590 Il17a Rat cadmium atom multiple interactions ISO Il17a (Mus musculus) 6480464 [ITPR3 mutant form results in increased susceptibility to Cadmium] which results in increased expression of IL17A mRNA and Cadmium promotes the reaction [ITPR3 mutant form results in increased expression of IL17A mRNA] CTD PMID:37047547 Il17a Rat calciol multiple interactions ISO Il17a (Mus musculus) 6480464 Cholecalciferol inhibits the reaction [bisphenol A results in increased secretion of IL17A protein] CTD PMID:32702508 Il17a Rat cannabidiol multiple interactions ISO Il17a (Mus musculus) 6480464 Cannabidiol inhibits the reaction [[myelin oligodendrocyte glycoprotein (35-55) results in increased susceptibility to myelin oligodendrocyte glycoprotein (35-55)] which results in increased expression of and results in increased secretion of IL17A protein] CTD PMID:30123217 Il17a Rat capmatinib multiple interactions ISO Il17a (Mus musculus) 6480464 capmatinib inhibits the reaction [Diethylnitrosamine results in increased secretion of IL17A protein] CTD PMID:27553677 Il17a Rat carbamazepine increases expression EXP 6480464 Carbamazepine results in increased expression of IL17A CTD PMID:28267586 Il17a Rat carbon monoxide multiple interactions ISO Il17a (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Carbon Monoxide co-treated with Nitrogen Oxides co-treated with Sulfur Dioxide]] which results in increased expression of IL17A protein CTD PMID:29621558 Il17a Rat carbon nanotube increases expression ISO Il17a (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of IL17A mRNA CTD PMID:22293422 Il17a Rat celastrol multiple interactions ISO Il17a (Mus musculus) 6480464 [celastrol co-treated with coomassie Brilliant Blue] inhibits the reaction [Acetaminophen results in increased expression of IL17A protein] and celastrol inhibits the reaction [Dextran Sulfate results in increased expression of IL17A protein] CTD PMID:24384223 and PMID:28435131 Il17a Rat celecoxib multiple interactions ISO Il17a (Mus musculus) 6480464 Celecoxib inhibits the reaction [deoxynivalenol results in increased expression of IL17A protein] CTD PMID:32416088 Il17a Rat chloroquine multiple interactions ISO Il17a (Mus musculus) 6480464 Chloroquine inhibits the reaction [Imiquimod results in increased expression of IL17A protein] more ... CTD PMID:22341560 and PMID:36002070 Il17a Rat chlorpyrifos increases expression ISO IL17A (Homo sapiens) 6480464 Chlorpyrifos results in increased expression of IL17A mRNA CTD PMID:22265773 Il17a Rat chlorpyrifos increases methylation EXP 6480464 Chlorpyrifos results in increased methylation of IL17A gene CTD PMID:32905263 Il17a Rat choline multiple interactions ISO Il17a (Mus musculus) 6480464 [Dietary Fats co-treated with Choline deficiency] results in increased expression of IL17A protein and PANX1 gene mutant form inhibits the reaction [[Dietary Fats co-treated with Choline deficiency] results in increased expression of IL17A protein] CTD PMID:29246445 Il17a Rat chrysene multiple interactions ISO Il17a (Mus musculus) 6480464 [chrysene co-treated with Tobacco Smoke Pollution] results in increased expression of IL17A mRNA more ... CTD PMID:33345606 Il17a Rat chrysin multiple interactions ISO Il17a (Mus musculus) 6480464 chrysin inhibits the reaction [Diazinon results in increased expression of IL17A mRNA] CTD PMID:36114367 Il17a Rat cisplatin multiple interactions ISO Il17a (Mus musculus) 6480464 Curcumin inhibits the reaction [Cisplatin results in increased expression of IL17A protein] CTD PMID:36178099 Il17a Rat cisplatin increases expression ISO Il17a (Mus musculus) 6480464 Cisplatin results in increased expression of IL17A protein CTD PMID:36178099 Il17a Rat corosolic acid multiple interactions ISO Il17a (Mus musculus) 6480464 corosolic acid analog inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of IL17A mRNA] and corosolic acid inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of IL17A mRNA] CTD PMID:26513295 Il17a Rat cortisol multiple interactions ISO IL17A (Homo sapiens) 6480464 [Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA and Rosmarinic Acid inhibits the reaction [[Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA] CTD PMID:33476690 Il17a Rat curcumin multiple interactions ISO Il17a (Mus musculus) 6480464 Curcumin inhibits the reaction [[Ovalbumin co-treated with lipopolysaccharide more ... CTD PMID:34998855 more ... Il17a Rat cyanidin cation multiple interactions ISO Il17a (Mus musculus) 6480464 [cyanidin inhibits the reaction [[IL17A protein co-treated with Freund's Adjuvant] results in increased expression of and results in increased phosphorylation of STAT3 protein]] which results in increased expression of PIAS3 protein more ... CTD PMID:32044269 Il17a Rat cycloastragenol multiple interactions EXP 267358468 cycloastragenol inhibits the reaction [acute myocardial infarction increases expression of Il17 protein in spleenocytes and peripheral blood] RGD Il17a Rat cycloheximide multiple interactions ISO Il17a (Mus musculus) 6480464 Cycloheximide inhibits the reaction [Glucose results in increased secretion of IL17A protein] CTD PMID:18310510 Il17a Rat cyclophosphamide decreases expression ISO Il17a (Mus musculus) 6480464 Cyclophosphamide results in decreased expression of IL17A protein CTD PMID:21880982 and PMID:32151603 Il17a Rat cyclophosphamide multiple interactions ISO Il17a (Mus musculus) 6480464 Fungal Polysaccharides inhibits the reaction [Cyclophosphamide results in decreased expression of IL17A protein] and Levamisole inhibits the reaction [Cyclophosphamide results in decreased expression of IL17A protein] CTD PMID:32151603 Il17a Rat D-glucose increases secretion ISO Il17a (Mus musculus) 6480464 Glucose results in increased secretion of IL17A protein CTD PMID:18310510 Il17a Rat D-glucose increases expression ISO Il17a (Mus musculus) 6480464 Glucose results in increased expression of IL17A mRNA CTD PMID:18310510 Il17a Rat D-glucose multiple interactions ISO Il17a (Mus musculus) 6480464 Cycloheximide inhibits the reaction [Glucose results in increased secretion of IL17A protein] more ... CTD PMID:18310510 Il17a Rat daidzein multiple interactions ISO Il17a (Mus musculus) 6480464 daidzein promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] CTD PMID:25583575 Il17a Rat decabromodiphenyl ether increases expression ISO Il17a (Mus musculus) 6480464 decabromobiphenyl ether results in increased expression of IL17A protein CTD PMID:30836164 Il17a Rat decabromodiphenyl ether multiple interactions ISO Il17a (Mus musculus) 6480464 [lead chloride results in increased abundance of Lead] promotes the reaction [decabromobiphenyl ether results in increased expression of IL17A protein] and decabromobiphenyl ether promotes the reaction [[lead chloride results in increased abundance of Lead] which results in increased expression of IL17A protein] CTD PMID:30836164 Il17a Rat deoxynivalenol multiple interactions ISO Il17a (Mus musculus) 6480464 [deoxynivalenol results in increased susceptibility to Antigens] which results in increased expression of IL17A protein and Celecoxib inhibits the reaction [deoxynivalenol results in increased expression of IL17A protein] CTD PMID:28935500 and PMID:32416088 Il17a Rat deoxynivalenol increases expression ISO Il17a (Mus musculus) 6480464 deoxynivalenol results in increased expression of IL17A protein CTD PMID:32416088 Il17a Rat dexamethasone decreases expression ISO Il17a (Mus musculus) 6480464 Dexamethasone results in decreased expression of IL17A protein CTD PMID:19997594 and PMID:21880982 Il17a Rat dexamethasone multiple interactions ISO Il17a (Mus musculus) 6480464 Dexamethasone inhibits the reaction [Ovalbumin results in increased expression of IL17A mRNA] and Dexamethasone inhibits the reaction [Ovalbumin results in increased expression of IL17A protein] CTD PMID:31669322 and PMID:37004399 Il17a Rat dexamethasone multiple interactions ISO IL17A (Homo sapiens) 6480464 [Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA and Rosmarinic Acid inhibits the reaction [[Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA] CTD PMID:33476690 Il17a Rat dextran sulfate multiple interactions ISO Il17a (Mus musculus) 6480464 2-(1'H-indole-3'-carbonyl)thiazole-4-carboxylic acid methyl ester inhibits the reaction [Dextran Sulfate results in increased expression of IL17A protein] more ... CTD PMID:21068411 more ... Il17a Rat dextran sulfate increases expression ISO Il17a (Mus musculus) 6480464 Dextran Sulfate results in increased expression of IL17A mRNA and Dextran Sulfate results in increased expression of IL17A protein CTD PMID:24384223 more ... Il17a Rat dextran sulfate multiple interactions EXP 6480464 kappa-casein glycomacropeptide inhibits the reaction [Dextran Sulfate results in increased expression of IL17A mRNA] CTD PMID:20881082 Il17a Rat dextran sulfate increases expression EXP 6480464 Dextran Sulfate results in increased expression of IL17A mRNA CTD PMID:20881082 Il17a Rat dextran sulfate affects response to substance ISO Il17a (Mus musculus) 6480464 IL17A protein affects the susceptibility to Dextran Sulfate CTD PMID:21068411 Il17a Rat diarsenic trioxide decreases expression ISO IL17A (Homo sapiens) 6480464 Arsenic Trioxide results in decreased expression of IL17A mRNA and Arsenic Trioxide results in decreased expression of IL17A protein CTD PMID:29950232 and PMID:34108876 Il17a Rat diarsenic trioxide decreases secretion ISO IL17A (Homo sapiens) 6480464 Arsenic Trioxide results in decreased secretion of IL17A protein CTD PMID:34108876 Il17a Rat diazinon increases expression ISO Il17a (Mus musculus) 6480464 Diazinon results in increased expression of IL17A mRNA and Diazinon results in increased expression of IL17A protein CTD PMID:36114367 Il17a Rat diazinon multiple interactions ISO Il17a (Mus musculus) 6480464 chrysin inhibits the reaction [Diazinon results in increased expression of IL17A mRNA] CTD PMID:36114367 Il17a Rat dibenziodolium multiple interactions ISO Il17a (Mus musculus) 6480464 diphenyleneiodonium inhibits the reaction [IL17A protein results in increased phosphorylation of MYL9 protein] CTD PMID:19940258 Il17a Rat dibutyl phthalate multiple interactions EXP 6480464 [Iodine co-treated with Dibutyl Phthalate] results in increased expression of IL17A protein and pyrazolanthrone inhibits the reaction [[Iodine co-treated with Dibutyl Phthalate] results in increased expression of IL17A protein] CTD PMID:29385629 Il17a Rat dibutyl phthalate multiple interactions ISO Il17a (Mus musculus) 6480464 Dibutyl Phthalate promotes the reaction [OVAL results in increased expression of IL17A protein] and Melatonin inhibits the reaction [Dibutyl Phthalate promotes the reaction [OVAL results in increased expression of IL17A protein]] CTD PMID:32446102 Il17a Rat diclofenac increases expression ISO Il17a (Mus musculus) 6480464 Diclofenac results in increased expression of IL17A protein CTD PMID:22285467 Il17a Rat diclofenac multiple interactions EXP 6480464 Diclofenac inhibits the reaction [Freund's Adjuvant results in increased expression of IL17A protein] CTD PMID:25450234 Il17a Rat digoxigenin multiple interactions ISO IL17A (Homo sapiens) 6480464 Digoxigenin results in increased expression of and results in increased secretion of IL17A protein CTD PMID:29981919 Il17a Rat digoxin multiple interactions ISO Il17a (Mus musculus) 6480464 Digoxin inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] and Digoxin inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A protein] CTD PMID:22292739 Il17a Rat dihydroouabain multiple interactions ISO IL17A (Homo sapiens) 6480464 dihydroouabain results in increased expression of and results in increased secretion of IL17A protein CTD PMID:29981919 Il17a Rat diiodine multiple interactions EXP 6480464 [Iodine co-treated with Dibutyl Phthalate] results in increased expression of IL17A protein and pyrazolanthrone inhibits the reaction [[Iodine co-treated with Dibutyl Phthalate] results in increased expression of IL17A protein] CTD PMID:29385629 Il17a Rat diiodine increases expression ISO Il17a (Mus musculus) 6480464 Iodine results in increased expression of IL17A protein CTD PMID:37598415 Il17a Rat diisononyl phthalate multiple interactions ISO Il17a (Mus musculus) 6480464 [Formaldehyde co-treated with diisononyl phthalate] promotes the reaction [OVAL protein results in increased secretion of [IL17A protein binds to IL17F protein]] and dehydroxymethylepoxyquinomicin inhibits the reaction [[Formaldehyde co-treated with diisononyl phthalate] promotes the reaction [OVAL protein results in increased secretion of [IL17A protein binds to IL17F protein]]] CTD PMID:29758289 Il17a Rat dimethylarsinic acid multiple interactions ISO IL17A (Homo sapiens) 6480464 [Arsenic results in increased abundance of Cacodylic Acid] which affects the expression of IL17A mRNA CTD PMID:28793237 Il17a Rat doxorubicin increases expression EXP 6480464 Doxorubicin results in increased expression of IL17A protein CTD PMID:34392583 Il17a Rat doxorubicin multiple interactions EXP 6480464 thymoquinone inhibits the reaction [Doxorubicin results in increased expression of IL17A protein] CTD PMID:34392583 Il17a Rat enilconazole multiple interactions ISO Il17a (Mus musculus) 6480464 enilconazole inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] CTD PMID:22289359 Il17a Rat enilconazole increases expression ISO Il17a (Mus musculus) 6480464 enilconazole results in increased expression of IL17A mRNA CTD PMID:32814239 Il17a Rat ethanol increases expression ISO Il17a (Mus musculus) 6480464 Ethanol results in increased expression of IL17A protein CTD PMID:28843478 Il17a Rat ethanol decreases expression ISO IL17A (Homo sapiens) 6480464 Ethanol results in decreased expression of IL17A protein CTD PMID:26733986 Il17a Rat Evodiamine multiple interactions ISO Il17a (Mus musculus) 6480464 [APC protein mutant form affects the susceptibility to evodiamine] which affects the expression of IL17A protein and evodiamine inhibits the reaction [Imiquimod results in increased expression of IL17A protein] CTD PMID:35362542 and PMID:38948922 Il17a Rat ferric oxide multiple interactions ISO Il17a (Mus musculus) 6480464 ferric oxide results in increased expression of and results in increased secretion of IL17A protein CTD PMID:34982504 Il17a Rat ferulic acid multiple interactions ISO Il17a (Mus musculus) 6480464 ferulic acid inhibits the reaction [Imiquimod results in increased expression of IL17A mRNA] and ferulic acid inhibits the reaction [Imiquimod results in increased expression of IL17A protein] CTD PMID:31054998 Il17a Rat flucloxacillin multiple interactions ISO Il17a (Mus musculus) 6480464 [IL17A protein co-treated with Floxacillin] results in increased expression of MPO protein and IL17A protein promotes the reaction [Floxacillin results in increased expression of GPT protein] CTD PMID:24652713 Il17a Rat fluorescein 5-isothiocyanate multiple interactions ISO Il17a (Mus musculus) 6480464 [Fluorescein-5-isothiocyanate co-treated with tributyrin] results in increased secretion of IL17A protein CTD PMID:36870414 Il17a Rat formaldehyde increases expression EXP 6480464 Formaldehyde results in increased expression of IL17A mRNA CTD PMID:28005965 Il17a Rat formaldehyde multiple interactions ISO Il17a (Mus musculus) 6480464 [Formaldehyde co-treated with diisononyl phthalate] promotes the reaction [OVAL protein results in increased secretion of [IL17A protein binds to IL17F protein]] and dehydroxymethylepoxyquinomicin inhibits the reaction [[Formaldehyde co-treated with diisononyl phthalate] promotes the reaction [OVAL protein results in increased secretion of [IL17A protein binds to IL17F protein]]] CTD PMID:29758289 Il17a Rat formononetin multiple interactions ISO Il17a (Mus musculus) 6480464 formononetin promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] CTD PMID:25583575 Il17a Rat fragrance increases expression ISO IL17A (Homo sapiens) 6480464 Perfume results in increased expression of IL17A mRNA CTD PMID:24768652 Il17a Rat fructose increases expression EXP 6480464 Fructose results in increased expression of IL17A protein CTD PMID:31661889 Il17a Rat fructose multiple interactions EXP 6480464 Fructose promotes the reaction [bisphenol A results in increased expression of IL17A protein] CTD PMID:31661889 Il17a Rat fulvestrant multiple interactions ISO Il17a (Mus musculus) 6480464 fulvestrant inhibits the reaction [Estradiol inhibits the reaction [Halothane results in increased expression of IL17A protein]] CTD PMID:21501669 Il17a Rat furan increases expression EXP 6480464 furan results in increased expression of IL17A mRNA CTD PMID:27387713 Il17a Rat genistein multiple interactions ISO Il17a (Mus musculus) 6480464 Genistein promotes the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] CTD PMID:25583575 Il17a Rat geraniol multiple interactions ISO Il17a (Mus musculus) 6480464 geraniol inhibits the reaction [Dextran Sulfate results in increased expression of IL17A protein] CTD PMID:26973525 Il17a Rat glucose increases secretion ISO Il17a (Mus musculus) 6480464 Glucose results in increased secretion of IL17A protein CTD PMID:18310510 Il17a Rat glucose increases expression ISO Il17a (Mus musculus) 6480464 Glucose results in increased expression of IL17A mRNA CTD PMID:18310510 Il17a Rat glucose multiple interactions ISO Il17a (Mus musculus) 6480464 Cycloheximide inhibits the reaction [Glucose results in increased secretion of IL17A protein] more ... CTD PMID:18310510 Il17a Rat glyburide multiple interactions EXP 6480464 Glyburide promotes the reaction [Isoproterenol results in increased expression of IL17A protein] and pyrvinium inhibits the reaction [Glyburide promotes the reaction [Isoproterenol results in increased expression of IL17A protein]] CTD PMID:35305975 Il17a Rat gossypin multiple interactions EXP 6480464 gossypin inhibits the reaction [Lipopolysaccharides results in increased expression of IL17A protein] CTD PMID:37148149 Il17a Rat halothane increases expression ISO Il17a (Mus musculus) 6480464 Halothane results in increased expression of IL17A protein CTD PMID:19633216 and PMID:21501669 Il17a Rat halothane multiple interactions ISO Il17a (Mus musculus) 6480464 Estradiol inhibits the reaction [Halothane results in increased expression of IL17A protein] more ... CTD PMID:21501669 Il17a Rat hexaconazole multiple interactions ISO Il17a (Mus musculus) 6480464 hexaconazole inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] CTD PMID:22289359 Il17a Rat hispidulin multiple interactions ISO Il17a (Mus musculus) 6480464 hispidulin inhibits the reaction [Imiquimod results in increased expression of IL17A mRNA] CTD PMID:32679548 Il17a Rat hydroquinone increases secretion EXP 6480464 hydroquinone results in increased secretion of IL17A protein CTD PMID:29935983 Il17a Rat hydroxysafflor yellow A multiple interactions ISO Il17a (Mus musculus) 6480464 hydroxysafflor yellow A inhibits the reaction [Ovalbumin results in increased expression of IL17A protein] CTD PMID:37195255 Il17a Rat imiquimod multiple interactions ISO Il17a (Mus musculus) 6480464 (+)-JQ1 compound inhibits the reaction [Imiquimod results in increased expression of IL17A mRNA] more ... CTD PMID:25965695 more ... Il17a Rat imiquimod increases secretion ISO Il17a (Mus musculus) 6480464 imiquimod results in increased secretion of IL17A protein CTD PMID:26149470 Il17a Rat imiquimod increases expression ISO Il17a (Mus musculus) 6480464 Imiquimod results in increased expression of IL17A mRNA and Imiquimod results in increased expression of IL17A protein CTD PMID:25965695 more ... Il17a Rat indometacin multiple interactions EXP 6480464 [morin co-treated with Indomethacin] inhibits the reaction [Freund's Adjuvant results in increased expression of IL17A mRNA] and Indomethacin inhibits the reaction [Freund's Adjuvant results in increased expression of IL17A mRNA] CTD PMID:25698669 Il17a Rat indometacin increases expression EXP 6480464 Indomethacin results in increased expression of IL17A mRNA CTD PMID:37676835 Il17a Rat ionomycin multiple interactions ISO Il17a (Mus musculus) 6480464 1 more ... CTD PMID:22289359 more ... Il17a Rat ionomycin multiple interactions ISO IL17A (Homo sapiens) 6480464 [Trinitrobenzenesulfonic Acid results in increased susceptibility to [Ionomycin co-treated with Tetradecanoylphorbol Acetate]] which results in increased expression of IL17A protein CTD PMID:27783946 Il17a Rat irinotecan increases expression ISO Il17a (Mus musculus) 6480464 Irinotecan results in increased expression of IL17A mRNA and Irinotecan results in increased expression of IL17A protein CTD PMID:26431797 Il17a Rat isoniazide increases secretion ISO IL17A (Homo sapiens) 6480464 Isoniazid results in increased secretion of IL17A protein CTD PMID:28444390 Il17a Rat isoprenaline increases expression EXP 6480464 Isoproterenol results in increased expression of IL17A protein CTD PMID:19909738 and PMID:35305975 Il17a Rat isoprenaline multiple interactions EXP 6480464 Glyburide promotes the reaction [Isoproterenol results in increased expression of IL17A protein] more ... CTD PMID:35305975 Il17a Rat lead(0) multiple interactions ISO Il17a (Mus musculus) 6480464 [lead chloride results in increased abundance of Lead] promotes the reaction [decabromobiphenyl ether results in increased expression of IL17A protein] more ... CTD PMID:30836164 Il17a Rat lead(0) increases expression ISO Il17a (Mus musculus) 6480464 Lead results in increased expression of IL17A mRNA CTD PMID:35760230 Il17a Rat lead(II) chloride multiple interactions ISO Il17a (Mus musculus) 6480464 [lead chloride results in increased abundance of Lead] promotes the reaction [decabromobiphenyl ether results in increased expression of IL17A protein] more ... CTD PMID:30836164 Il17a Rat leflunomide multiple interactions ISO Il17a (Mus musculus) 6480464 leflunomide inhibits the reaction [COL2A1 protein results in increased expression of IL17A protein] CTD PMID:26640276 Il17a Rat levamisole multiple interactions ISO Il17a (Mus musculus) 6480464 Levamisole inhibits the reaction [Cyclophosphamide results in decreased expression of IL17A protein] CTD PMID:32151603 Il17a Rat lipopolysaccharide increases secretion ISO Il17a (Mus musculus) 6480464 Lipopolysaccharides results in increased secretion of IL17A protein CTD PMID:32800949 Il17a Rat lipopolysaccharide multiple interactions EXP 6480464 gossypin inhibits the reaction [Lipopolysaccharides results in increased expression of IL17A protein] CTD PMID:37148149 Il17a Rat lipopolysaccharide increases expression EXP 6480464 Lipopolysaccharides results in increased expression of IL17A protein CTD PMID:37148149 Il17a Rat lipopolysaccharide increases expression ISO Il17a (Mus musculus) 6480464 Lipopolysaccharides results in increased expression of IL17A mRNA and Lipopolysaccharides results in increased expression of IL17A protein CTD PMID:21677146 and PMID:28600744 Il17a Rat lipopolysaccharide multiple interactions ISO Il17a (Mus musculus) 6480464 2'-hydroxyflavanone inhibits the reaction [Lipopolysaccharides results in increased secretion of IL17A protein] more ... CTD PMID:21677146 more ... Il17a Rat lipopolysaccharide multiple interactions ISO IL17A (Homo sapiens) 6480464 [bisphenol F co-treated with Lipopolysaccharides] results in increased expression of IL17A mRNA more ... CTD PMID:23199342 and PMID:34774955 Il17a Rat luteolin multiple interactions EXP 6480464 Luteolin inhibits the reaction [Freund's Adjuvant results in increased expression of IL17A protein] CTD PMID:25450234 Il17a Rat LY294002 multiple interactions ISO Il17a (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Toluene 2 and 4-Diisocyanate results in increased expression of IL17A mRNA] CTD PMID:17982072 Il17a Rat maslinic acid multiple interactions ISO Il17a (Mus musculus) 6480464 maslinic acid inhibits the reaction [Tetradecanoylphorbol Acetate results in increased expression of IL17A mRNA] CTD PMID:26513295 Il17a Rat melatonin multiple interactions ISO Il17a (Mus musculus) 6480464 IL17A protein affects the reaction [[Melatonin co-treated with Fluorides] results in increased expression of IL10 mRNA] more ... CTD PMID:32446102 more ... Il17a Rat mercury dichloride increases expression ISO Il17a (Mus musculus) 6480464 Mercuric Chloride results in increased expression of IL-17A protein CTD PMID:21984480 Il17a Rat mesalamine multiple interactions ISO Il17a (Mus musculus) 6480464 Mesalamine inhibits the reaction [Dextran Sulfate results in increased expression of IL17A mRNA] CTD PMID:33130971 Il17a Rat methotrexate decreases expression ISO IL17A (Homo sapiens) 6480464 Methotrexate results in decreased expression of IL17A mRNA CTD PMID:17400583 Il17a Rat methotrexate multiple interactions EXP 6480464 Methotrexate inhibits the reaction [Freund's Adjuvant results in increased expression of IL17A mRNA] and Methotrexate inhibits the reaction [Freund's Adjuvant results in increased expression of IL17A protein] CTD PMID:27613480 Il17a Rat methoxychlor multiple interactions ISO Il17a (Mus musculus) 6480464 [Methoxychlor co-treated with Antigens and Dermatophagoides] affects the expression of IL17A protein CTD PMID:21864637 Il17a Rat methyl salicylate decreases expression ISO Il17a (Mus musculus) 6480464 methyl salicylate results in decreased expression of IL17A protein CTD PMID:28826779 Il17a Rat methylene blue multiple interactions EXP 6480464 Methylene Blue inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of IL17A protein] CTD PMID:31428839 Il17a Rat methylmercury chloride increases expression EXP 6480464 methylmercuric chloride results in increased expression of IL17A protein CTD PMID:28526320 Il17a Rat Methysticin multiple interactions ISO Il17a (Mus musculus) 6480464 methysticin inhibits the reaction [[PSEN1 protein co-treated with APP protein] results in increased secretion of IL17A protein] CTD PMID:28448946 Il17a Rat metyrapone multiple interactions EXP 6480464 Metyrapone inhibits the reaction [Ozone results in increased expression of IL17A protein] CTD PMID:27037194 Il17a Rat mevalonic acid multiple interactions ISO IL17A (Homo sapiens) 6480464 Mevalonic Acid inhibits the reaction [Simvastatin results in decreased expression of IL17A mRNA] CTD PMID:18453621 Il17a Rat microcystin-LR multiple interactions EXP 6480464 [Dietary Fats co-treated with Cholesterol and Dietary co-treated with cyanoginosin LR] results in decreased expression of IL17A protein CTD PMID:34740672 Il17a Rat microcystin-LR increases secretion EXP 6480464 cyanoginosin LR results in increased secretion of IL17A protein CTD PMID:37467923 Il17a Rat microcystin-LR decreases expression EXP 6480464 cyanoginosin LR results in decreased expression of IL17A protein CTD PMID:34740672 Il17a Rat mifepristone multiple interactions ISO Il17a (Mus musculus) 6480464 Mifepristone inhibits the reaction [Progesterone promotes the reaction [Halothane results in increased expression of IL17A protein]] CTD PMID:21501669 Il17a Rat ML-7 multiple interactions ISO Il17a (Mus musculus) 6480464 ML 7 inhibits the reaction [IL17A protein results in increased phosphorylation of MYL9 protein] CTD PMID:19940258 Il17a Rat morin multiple interactions EXP 6480464 [morin co-treated with Indomethacin] inhibits the reaction [Freund's Adjuvant results in increased expression of IL17A mRNA] and morin inhibits the reaction [Freund's Adjuvant results in increased expression of IL17A mRNA] CTD PMID:25698669 Il17a Rat N-acetyl-L-cysteine multiple interactions ISO Il17a (Mus musculus) 6480464 Acetylcysteine inhibits the reaction [Azoxymethane results in increased expression of IL17A protein] and Acetylcysteine inhibits the reaction [Trichloroethylene results in increased expression of IL17A mRNA] CTD PMID:20431929 and PMID:23993974 Il17a Rat N-methyl-4-phenylpyridinium multiple interactions EXP 6480464 IL17A protein promotes the reaction [1-Methyl-4-phenylpyridinium results in decreased expression of IGF1 protein] more ... CTD PMID:31351185 Il17a Rat N-nitrosodiethylamine multiple interactions ISO Il17a (Mus musculus) 6480464 capmatinib inhibits the reaction [Diethylnitrosamine results in increased secretion of IL17A protein] CTD PMID:27553677 Il17a Rat N-nitrosodiethylamine increases secretion ISO Il17a (Mus musculus) 6480464 Diethylnitrosamine results in increased secretion of IL17A protein CTD PMID:27553677 Il17a Rat N-tosyl-L-phenylalanyl chloromethyl ketone multiple interactions ISO IL17A (Homo sapiens) 6480464 Tosylphenylalanyl Chloromethyl Ketone inhibits the reaction [IL17A protein results in increased activity of NFKB1 protein] more ... CTD PMID:12016129 Il17a Rat nickel atom increases expression ISO IL17A (Homo sapiens) 6480464 Nickel results in increased expression of IL17A mRNA CTD PMID:24768652 Il17a Rat nicotine multiple interactions ISO IL17A (Homo sapiens) 6480464 [Lipopolysaccharides co-treated with Nicotine] results in increased expression of IL17A mRNA more ... CTD PMID:23199342 Il17a Rat ochratoxin A multiple interactions ISO Il17a (Mus musculus) 6480464 [ochratoxin A results in increased susceptibility to Antigens] which results in increased expression of IL17A protein CTD PMID:28935500 Il17a Rat ozone multiple interactions ISO Il17a (Mus musculus) 6480464 [[Air Pollutants results in increased abundance of Ozone] which results in increased expression of SAA3 mRNA] which results in increased expression of IL17A mRNA more ... CTD PMID:22474022 more ... Il17a Rat ozone increases expression ISO IL17A (Homo sapiens) 6480464 Ozone results in increased expression of IL17A mRNA CTD PMID:23665308 Il17a Rat ozone multiple interactions ISO IL17A (Homo sapiens) 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of IL17A mRNA CTD PMID:28046113 Il17a Rat ozone multiple interactions EXP 6480464 [Air Pollutants results in increased abundance of Ozone] which results in increased expression of IL17A mRNA more ... CTD PMID:27037194 and PMID:34790285 Il17a Rat ozone increases expression EXP 6480464 Ozone results in increased expression of IL17A protein CTD PMID:27037194 Il17a Rat ozone increases expression ISO Il17a (Mus musculus) 6480464 Ozone results in increased expression of IL17A mRNA and Ozone results in increased expression of IL17A protein CTD PMID:23755285 more ... Il17a Rat paracetamol increases expression ISO Il17a (Mus musculus) 6480464 Acetaminophen results in increased expression of IL17A protein CTD PMID:28435131 Il17a Rat paracetamol multiple interactions ISO Il17a (Mus musculus) 6480464 [celastrol co-treated with coomassie Brilliant Blue] inhibits the reaction [Acetaminophen results in increased expression of IL17A protein] CTD PMID:28435131 Il17a Rat paraquat multiple interactions ISO Il17a (Mus musculus) 6480464 IL17A protein promotes the reaction [Paraquat results in increased expression of and affects the localization of RELA protein] more ... CTD PMID:28600744 Il17a Rat paraquat increases expression ISO IL17A (Homo sapiens) 6480464 Paraquat results in increased expression of IL17A protein CTD PMID:36108500 Il17a Rat paraquat increases expression ISO Il17a (Mus musculus) 6480464 Paraquat results in increased expression of IL17A mRNA and Paraquat results in increased expression of IL17A protein CTD PMID:28600744 and PMID:36108500 Il17a Rat parathion multiple interactions ISO Il17a (Mus musculus) 6480464 [Parathion co-treated with Antigens and Dermatophagoides] affects the expression of IL17A protein CTD PMID:21864637 Il17a Rat paroxetine multiple interactions ISO IL17A (Homo sapiens) 6480464 LY 215840 inhibits the reaction [Paroxetine results in decreased expression of IL17A protein] CTD PMID:32020710 Il17a Rat paroxetine decreases expression ISO IL17A (Homo sapiens) 6480464 Paroxetine results in decreased expression of IL17A protein CTD PMID:32020710 Il17a Rat pentachlorophenol increases expression ISO IL17A (Homo sapiens) 6480464 Pentachlorophenol results in increased expression of IL17A mRNA CTD PMID:35550411 Il17a Rat phenytoin multiple interactions ISO Il17a (Mus musculus) 6480464 [Phenytoin co-treated with Buthionine Sulfoximine] results in increased secretion of IL17A protein CTD PMID:23986454 Il17a Rat phorbol 13-acetate 12-myristate multiple interactions ISO Il17a (Mus musculus) 6480464 1 more ... CTD PMID:22289359 more ... Il17a Rat phorbol 13-acetate 12-myristate multiple interactions ISO IL17A (Homo sapiens) 6480464 [Trinitrobenzenesulfonic Acid results in increased susceptibility to [Ionomycin co-treated with Tetradecanoylphorbol Acetate]] which results in increased expression of IL17A protein CTD PMID:27783946 Il17a Rat phorbol 13-acetate 12-myristate increases expression ISO Il17a (Mus musculus) 6480464 Tetradecanoylphorbol Acetate results in increased expression of IL17A mRNA CTD PMID:26513295 Il17a Rat phosmet increases expression ISO IL17A (Homo sapiens) 6480464 Phosmet results in increased expression of IL17A mRNA CTD PMID:22265773 Il17a Rat phytoestrogen decreases expression ISO Il17a (Mus musculus) 6480464 Phytoestrogens results in decreased expression of IL17A protein CTD PMID:24388399 Il17a Rat piperonyl butoxide increases expression ISO Il17a (Mus musculus) 6480464 Piperonyl Butoxide results in increased expression of IL17A mRNA CTD PMID:22842586 Il17a Rat pirinixic acid multiple interactions ISO Il17a (Mus musculus) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in increased expression of IL17A mRNA CTD PMID:19710929 Il17a Rat platycodin D multiple interactions ISO Il17a (Mus musculus) 6480464 platycodin D inhibits the reaction [[IL6 protein co-treated with TGFB1 protein] results in increased expression of and results in increased secretion of IL17A protein] and platycodin D inhibits the reaction [Alloxan results in increased expression of and results in increased secretion of IL17A protein] CTD PMID:25887267 Il17a Rat poly(I:C) increases expression ISO Il17a (Mus musculus) 6480464 Poly I-C results in increased expression of IL17A protein CTD PMID:30836164 Il17a Rat prednisolone multiple interactions ISO Il17a (Mus musculus) 6480464 Prednisolone inhibits the reaction [Dinitrochlorobenzene results in increased expression of IL17A mRNA] CTD PMID:23133493 Il17a Rat prednisone multiple interactions ISO Il17a (Mus musculus) 6480464 Prednisone inhibits the reaction [FAS protein mutant form results in increased expression of IL17A protein] CTD PMID:38555047 Il17a Rat procymidone increases expression ISO Il17a (Mus musculus) 6480464 procymidone results in increased expression of IL17A mRNA CTD PMID:36764477 Il17a Rat procymidone affects expression ISO Il17a (Mus musculus) 6480464 procymidone affects the expression of IL17A protein CTD PMID:36764477 Il17a Rat progesterone multiple interactions ISO Il17a (Mus musculus) 6480464 Mifepristone inhibits the reaction [Progesterone promotes the reaction [Halothane results in increased expression of IL17A protein]] more ... CTD PMID:21501669 and PMID:28279894 Il17a Rat propionic acid multiple interactions ISO Il17a (Mus musculus) 6480464 [propionic acid co-treated with enterotoxin B and staphylococcal] affects the expression of IL17A protein CTD PMID:32754917 Il17a Rat pyrrolidine dithiocarbamate multiple interactions ISO IL17A (Homo sapiens) 6480464 pyrrolidine dithiocarbamic acid inhibits the reaction [IL17A protein results in increased activity of NFKB1 protein] more ... CTD PMID:12016129 Il17a Rat pyrvinium multiple interactions EXP 6480464 pyrvinium inhibits the reaction [Glyburide promotes the reaction [Isoproterenol results in increased expression of IL17A protein]] and pyrvinium inhibits the reaction [Isoproterenol results in increased expression of IL17A protein] CTD PMID:35305975 Il17a Rat resveratrol multiple interactions ISO IL17A (Homo sapiens) 6480464 resveratrol inhibits the reaction [[Lipopolysaccharides co-treated with Nicotine] results in increased expression of IL17A mRNA] CTD PMID:23199342 Il17a Rat resveratrol decreases expression ISO IL17A (Homo sapiens) 6480464 resveratrol results in decreased expression of IL17A mRNA CTD PMID:23224687 Il17a Rat resveratrol multiple interactions ISO Il17a (Mus musculus) 6480464 resveratrol inhibits the reaction [Dextran Sulfate results in increased expression of IL17A protein] more ... CTD PMID:18310510 more ... Il17a Rat Rhein increases expression ISO Il17a (Mus musculus) 6480464 rhein results in increased expression of IL17A protein CTD PMID:26784856 Il17a Rat rosmarinic acid multiple interactions ISO IL17A (Homo sapiens) 6480464 Rosmarinic Acid inhibits the reaction [[Rosiglitazone co-treated with TF protein co-treated with INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Hydrocortisone co-treated with Triiodothyronine] results in decreased expression of IL17A mRNA] CTD PMID:33476690 Il17a Rat rutin multiple interactions ISO Il17a (Mus musculus) 6480464 Rutin inhibits the reaction [FAS protein mutant form results in increased expression of IL17A protein] CTD PMID:38555047 Il17a Rat ruxolitinib multiple interactions ISO Il17a (Mus musculus) 6480464 ruxolitinib inhibits the reaction [Carbon Tetrachloride results in increased secretion of and results in decreased expression of IL17A protein] CTD PMID:24973641 Il17a Rat S-butyl-DL-homocysteine (S,R)-sulfoximine multiple interactions ISO Il17a (Mus musculus) 6480464 [Phenytoin co-treated with Buthionine Sulfoximine] results in increased secretion of IL17A protein CTD PMID:23986454 Il17a Rat SB 203580 multiple interactions ISO IL17A (Homo sapiens) 6480464 SB 203580 inhibits the reaction [IL17A protein promotes the reaction [TNF protein results in increased expression of IL6 mRNA]] more ... CTD PMID:12016129 Il17a Rat SB-239063 multiple interactions ISO Il17a (Mus musculus) 6480464 SB 239063 inhibits the reaction [Ozone promotes the reaction [Ovalbumin results in increased expression of IL17A mRNA]] CTD PMID:29284473 Il17a Rat silicon dioxide increases expression ISO Il17a (Mus musculus) 6480464 Silicon Dioxide results in increased expression of IL17A mRNA and Silicon Dioxide results in increased expression of IL17A protein CTD PMID:20421647 Il17a Rat silicon dioxide multiple interactions ISO Il17a (Mus musculus) 6480464 IL17A protein affects the reaction [Silicon Dioxide results in increased expression of CXCL1 protein] more ... CTD PMID:20421647 Il17a Rat simvastatin decreases expression ISO IL17A (Homo sapiens) 6480464 Simvastatin results in decreased expression of IL17A mRNA CTD PMID:18453621 Il17a Rat simvastatin multiple interactions ISO IL17A (Homo sapiens) 6480464 IFNG affects the reaction [Simvastatin results in decreased expression of IL17A mRNA] more ... CTD PMID:18453621 Il17a Rat simvastatin decreases secretion ISO IL17A (Homo sapiens) 6480464 Simvastatin results in decreased secretion of IL17A protein CTD PMID:18453621 and PMID:21856936 Il17a Rat sirolimus multiple interactions ISO Il17a (Mus musculus) 6480464 Sirolimus inhibits the reaction [Trichloroethylene results in increased expression of IL17A protein] CTD PMID:36849104 Il17a Rat sodium arsenate multiple interactions ISO IL17A (Homo sapiens) 6480464 METTL3 protein promotes the reaction [sodium arsenate results in increased expression of IL17A protein] CTD PMID:35363433 Il17a Rat sodium arsenite increases expression EXP 6480464 sodium arsenite results in increased expression of IL17A protein CTD PMID:34251737 Il17a Rat sodium arsenite decreases expression ISO Il17a (Mus musculus) 6480464 sodium arsenite results in decreased expression of IL17A mRNA CTD PMID:36435854 Il17a Rat sodium arsenite multiple interactions EXP 6480464 Ginkgo biloba extract inhibits the reaction [sodium arsenite results in increased expression of IL17A protein] CTD PMID:34251737 Il17a Rat sodium dodecyl sulfate increases expression ISO Il17a (Mus musculus) 6480464 Sodium Dodecyl Sulfate results in increased expression of IL17A mRNA and Sodium Dodecyl Sulfate results in increased expression of IL17A protein CTD PMID:28826779 Il17a Rat sodium fluoride increases expression ISO Il17a (Mus musculus) 6480464 Sodium Fluoride results in increased expression of IL17A mRNA and Sodium Fluoride results in increased expression of IL17A protein CTD PMID:30225638 Il17a Rat sodium taurocholate increases expression EXP 9068935 Sodium taurocholate increases expression of Il17a mRNA and protein in the pancreas RGD Il17a Rat streptozocin multiple interactions EXP 6480464 stannous mesoporphyrin inhibits the reaction [4-(4-(3-adamantan-1-ylureido)cyclohexyloxy)benzoic acid inhibits the reaction [Streptozocin results in increased expression of IL17A protein]] CTD PMID:23611540 Il17a Rat streptozocin increases expression EXP 6480464 Streptozocin results in increased expression of IL17A protein CTD PMID:23611540 Il17a Rat strophanthidin multiple interactions ISO IL17A (Homo sapiens) 6480464 Strophanthidin results in increased expression of and results in increased secretion of IL17A protein CTD PMID:29981919 Il17a Rat sulfasalazine multiple interactions EXP 6480464 Sulfasalazine inhibits the reaction [Trinitrobenzenesulfonic Acid results in increased expression of IL17A protein] CTD PMID:31428839 Il17a Rat sulfur dioxide multiple interactions ISO Il17a (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Carbon Monoxide co-treated with Nitrogen Oxides co-treated with Sulfur Dioxide]] which results in increased expression of IL17A protein CTD PMID:29621558 Il17a Rat tamibarotene multiple interactions ISO Il17a (Mus musculus) 6480464 IL17A affects the reaction [tamibarotene results in decreased expression of TGFB1 mRNA] CTD PMID:22077062 Il17a Rat tetrachloromethane multiple interactions ISO Il17a (Mus musculus) 6480464 Carbon Tetrachloride results in increased secretion of and results in decreased expression of IL17A protein and ruxolitinib inhibits the reaction [Carbon Tetrachloride results in increased secretion of and results in decreased expression of IL17A protein] CTD PMID:24973641 Il17a Rat tetrachloromethane increases expression ISO Il17a (Mus musculus) 39939037 tetrachloromethane increases expression of Il17a protein in liver and serum RGD Il17a Rat tetrachloromethane increases expression ISO Il17a (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of IL17A protein CTD PMID:17412915 Il17a Rat tetraconazole multiple interactions ISO Il17a (Mus musculus) 6480464 tetraconazole inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] CTD PMID:22289359 Il17a Rat thymoquinone multiple interactions EXP 6480464 thymoquinone inhibits the reaction [Doxorubicin results in increased expression of IL17A protein] CTD PMID:34392583 Il17a Rat titanium dioxide affects expression ISO IL17A (Homo sapiens) 6480464 titanium dioxide affects the expression of IL17A mRNA CTD PMID:19695317 Il17a Rat titanium dioxide multiple interactions ISO Il17a (Mus musculus) 6480464 [titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of IL17A mRNA CTD PMID:29950665 Il17a Rat tofacitinib multiple interactions ISO IL17A (Homo sapiens) 6480464 tofacitinib inhibits the reaction [enterotoxin A and Staphylococcal results in increased expression of and results in increased secretion of IL17A protein] CTD PMID:26738536 Il17a Rat toluene 2,4-diisocyanate increases expression ISO Il17a (Mus musculus) 6480464 Toluene 2 more ... CTD PMID:17982072 and PMID:31577921 Il17a Rat toluene 2,4-diisocyanate increases secretion ISO Il17a (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in increased secretion of IL17A protein CTD PMID:31577921 Il17a Rat toluene 2,4-diisocyanate decreases expression ISO Il17a (Mus musculus) 6480464 Toluene 2 and 4-Diisocyanate results in decreased expression of IL17A protein CTD PMID:28826779 Il17a Rat toluene 2,4-diisocyanate multiple interactions ISO Il17a (Mus musculus) 6480464 2-(4-morpholinyl)-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [Toluene 2 more ... CTD PMID:17982072 and PMID:31577921 Il17a Rat tributyrin multiple interactions ISO Il17a (Mus musculus) 6480464 [Fluorescein-5-isothiocyanate co-treated with tributyrin] results in increased secretion of IL17A protein CTD PMID:36870414 Il17a Rat trichloroethene increases expression ISO Il17a (Mus musculus) 6480464 Trichloroethylene results in increased expression of IL17A mRNA and Trichloroethylene results in increased expression of IL17A protein CTD PMID:23993974 and PMID:36849104 Il17a Rat trichloroethene multiple interactions ISO Il17a (Mus musculus) 6480464 [Trichloroethylene co-treated with Dietary Fats] results in increased expression of IL17A mRNA more ... CTD PMID:23993974 more ... Il17a Rat triflumizole multiple interactions ISO Il17a (Mus musculus) 6480464 triflumizol inhibits the reaction [[Tetradecanoylphorbol Acetate co-treated with Ionomycin] results in increased expression of IL17A mRNA] CTD PMID:22289359 Il17a Rat Triptolide increases expression ISO Il17a (Mus musculus) 6480464 triptolide results in increased expression of IL17A mRNA and triptolide results in increased expression of IL17A protein CTD PMID:24949944 and PMID:36520315 Il17a Rat Triptolide decreases expression ISO IL17A (Homo sapiens) 6480464 triptolide results in decreased expression of IL17A mRNA CTD PMID:38115356 Il17a Rat Triptolide multiple interactions ISO Il17a (Mus musculus) 6480464 IL17A protein promotes the reaction [triptolide results in increased expression of CCL11 mRNA] more ... CTD PMID:24949944 Il17a Rat Tryptanthrine multiple interactions ISO IL17A (Homo sapiens) 6480464 tryptanthrine inhibits the reaction [[IL17A protein co-treated with TNF protein] results in increased expression of CCL20 mRNA] more ... CTD PMID:32173427 Il17a Rat vitamin K multiple interactions EXP 6480464 Vitamin K inhibits the reaction [9 more ... CTD PMID:33063951 Il17a Rat wogonin multiple interactions ISO Il17a (Mus musculus) 6480464 wogonin inhibits the reaction [Ovalbumin results in increased expression of IL17A protein] CTD PMID:37004399 Il17a Rat wortmannin multiple interactions ISO Il17a (Mus musculus) 6480464 wortmannin inhibits the reaction [Toluene 2 and 4-Diisocyanate results in increased expression of IL17A mRNA] CTD PMID:17982072
Imported Annotations - PID (archival)
acne (ISO) Acute Lung Injury (ISO) acute myocardial infarction (IEP) acute necrotizing pancreatitis (IEP) Acute Otitis Media (IEP) acute promyelocytic leukemia (ISO) allergic disease (ISO) allergic rhinitis (ISO) Animal Toxoplasmosis (ISO) ankylosing spondylitis (ISO) anti-basement membrane glomerulonephritis (IDA) Arterial Thrombosis (ISO) asthma (IEP,ISO) atherosclerosis (ISO) atopic dermatitis (ISO) autoimmune disease (ISO) autoimmune thyroiditis (ISO) Bacteremia (ISO) bacterial pneumonia (ISO) Behcet's disease (ISO) brain ischemia (IEP,ISO) Breast Neoplasms (ISO) Bronchial Hyperreactivity (ISO) bronchiolitis (ISO) bronchiolitis obliterans (ISO) cardiovascular system disease (ISO) central nervous system disease (ISO) cerebrovascular disease (ISO) Chemical and Drug Induced Liver Injury (ISO) Chemically-Induced Disorders (ISO) chlamydia (ISO) chronic obstructive pulmonary disease (IEP,ISO) Chronic Rhinosinusitis (ISO) colitis (IEP,ISO) congestive heart failure (IEP,IMP) corneal neovascularization (ISO) COVID-19 (ISO) Cryopyrin-Associated Periodic Syndromes (ISO) cutaneous leishmaniasis (ISO) cutaneous lupus erythematosus (ISO) cystic fibrosis (ISO) Delayed Hypersensitivity (IMP) Discoid Lupus Erythematosus (ISO) Drug Eruptions (ISO) Emphysema (ISO) Experimental Arthritis (IDA,IEP,IMP,ISO) Experimental Autoimmune Encephalomyelitis (IDA,IEP,ISO) Experimental Autoimmune Neuritis (IEP,ISO) Experimental Autoimmune Uveitis (IDA,IEP,IMP) Experimental Diabetes Mellitus (IEP) Experimental Liver Cirrhosis (IEP,ISO) extrinsic allergic alveolitis (ISO) graft-versus-host disease (ISO) Gram-Negative Bacterial Infections (ISO) Graves' disease (ISO) histoplasmosis (ISO) Human Influenza (ISO) Hyperalgesia (IDA,IMP) hypertension (ISO) Ige Responsiveness, Atopic (ISO) ileitis (IEP) Inflammation (ISO) invasive aspergillosis (ISO) kidney disease (ISO) leprosy (ISO) lipoid nephrosis (IEP) lupus nephritis (ISO) lymphoproliferative syndrome (ISO) macular degeneration (ISO) MPTP Poisoning (ISO) multiple sclerosis (ISO) Mycobacterium avium complex disease (ISO) myocardial infarction (IEP) Myocardial Reperfusion Injury (IMP) myocarditis (IDA) Nasal Polyps (ISO) Necrosis (ISO) Ocular Toxoplasmosis (ISO) otitis media (ISO) Perennial Allergic Rhinitis (ISO) periapical periodontitis (IEP) periodontal disease (IEP) plague (IEP) pleurisy (IDA) Pneumococcal Infections (ISO) Pneumococcal Pneumonia (ISO) pneumonia (ISO) psoriasis (ISO) psoriatic arthritis (ISO) pulmonary edema (ISO) pulmonary fibrosis (IEP,ISO) Respiratory Sounds (ISO) respiratory syncytial virus infectious disease (ISO) rheumatoid arthritis (ISO) rhinitis (ISO) Rhinosinusitis (ISO) Sepsis (IMP) silicosis (ISO) Sjogren's syndrome (ISO) Spondylarthritis (IEP) Staphylococcal Skin Infections (ISO) Streptococcal Infections (ISO) systemic lupus erythematosus (ISO) systemic scleroderma (ISO) temporal arteritis (ISO) trachoma (ISO) Transplant Rejection (IEP,IMP,ISO) tularemia (ISO) uveitis (IMP,ISO) Viral Bronchiolitis (ISO) Viral Myocarditis (ISO) vitiligo (ISO)
(+)-Tetrandrine (ISO) (R,R,R)-alpha-tocopherol (ISO) (S)-nicotine (ISO) (Z)-ligustilide (ISO) 1-(4'-hydroxy-3'-methoxyphenyl)-7-phenyl-3-heptanone (ISO) 1-chloro-2,4-dinitrobenzene (EXP,ISO) 1-fluoro-2,4-dinitrobenzene (ISO) 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO) 1-naphthyl isothiocyanate (ISO) 17alpha-ethynylestradiol (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (ISO) 2,4,6-trinitrobenzenesulfonic acid (EXP,ISO) 2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO) 3,3',5-triiodo-L-thyronine (ISO) 3,5-diethoxycarbonyl-1,4-dihydrocollidine (ISO) 3-acetyldeoxynivalenol (ISO) 3-isobutyl-1-methyl-7H-xanthine (ISO) 4,4'-sulfonyldiphenol (ISO) 4-hydroxy-TEMPO (ISO) 4-hydroxynon-2-enal (ISO) 4-phenylbutyric acid (ISO) 5-aza-2'-deoxycytidine (ISO) 6-O-alpha-D-glucopyranosyl-D-fructofuranose (ISO) 7,12-dimethyltetraphene (EXP) 7,9-dihydro-1H-purine-2,6,8(3H)-trione (EXP) acetic acid [2-[[(5-nitro-2-thiazolyl)amino]-oxomethyl]phenyl] ester (ISO) acetylsalicylic acid (ISO) actinomycin D (ISO) aflatoxin B1 (ISO) aldehydo-D-glucose (ISO) alloxan (ISO) alpha-amanitin (ISO) alpha-galactosylceramide (ISO) alpha-hexylcinnamaldehyde (ISO) ammonium chloride (EXP) amphibole asbestos (ISO) anthra[1,9-cd]pyrazol-6(2H)-one (EXP) antigen (ISO) apilimod (ISO) arsane (ISO) arsenic atom (ISO) arsenous acid (ISO) asbestos (ISO) Azoxymethane (ISO) Bardoxolone methyl (ISO) benzene (ISO) benzo[a]pyrene (EXP,ISO) beta-naphthoflavone (ISO) biochanin A (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bleomycin A2 (ISO) budesonide (ISO) Butylbenzyl phthalate (ISO) cadmium atom (EXP,ISO) calciol (ISO) cannabidiol (ISO) capmatinib (ISO) carbamazepine (EXP) carbon monoxide (ISO) carbon nanotube (ISO) celastrol (ISO) celecoxib (ISO) chloroquine (ISO) chlorpyrifos (EXP,ISO) choline (ISO) chrysene (ISO) chrysin (ISO) cisplatin (ISO) corosolic acid (ISO) cortisol (ISO) curcumin (ISO) cyanidin cation (ISO) cycloastragenol (EXP) cycloheximide (ISO) cyclophosphamide (ISO) D-glucose (ISO) daidzein (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) dexamethasone (ISO) dextran sulfate (EXP,ISO) diarsenic trioxide (ISO) diazinon (ISO) dibenziodolium (ISO) dibutyl phthalate (EXP,ISO) diclofenac (EXP,ISO) digoxigenin (ISO) digoxin (ISO) dihydroouabain (ISO) diiodine (EXP,ISO) diisononyl phthalate (ISO) dimethylarsinic acid (ISO) doxorubicin (EXP) enilconazole (ISO) ethanol (ISO) Evodiamine (ISO) ferric oxide (ISO) ferulic acid (ISO) flucloxacillin (ISO) fluorescein 5-isothiocyanate (ISO) formaldehyde (EXP,ISO) formononetin (ISO) fragrance (ISO) fructose (EXP) fulvestrant (ISO) furan (EXP) genistein (ISO) geraniol (ISO) glucose (ISO) glyburide (EXP) gossypin (EXP) halothane (ISO) hexaconazole (ISO) hispidulin (ISO) hydroquinone (EXP) hydroxysafflor yellow A (ISO) imiquimod (ISO) indometacin (EXP) ionomycin (ISO) irinotecan (ISO) isoniazide (ISO) isoprenaline (EXP) lead(0) (ISO) lead(II) chloride (ISO) leflunomide (ISO) levamisole (ISO) lipopolysaccharide (EXP,ISO) luteolin (EXP) LY294002 (ISO) maslinic acid (ISO) melatonin (ISO) mercury dichloride (ISO) mesalamine (ISO) methotrexate (EXP,ISO) methoxychlor (ISO) methyl salicylate (ISO) methylene blue (EXP) methylmercury chloride (EXP) Methysticin (ISO) metyrapone (EXP) mevalonic acid (ISO) microcystin-LR (EXP) mifepristone (ISO) ML-7 (ISO) morin (EXP) N-acetyl-L-cysteine (ISO) N-methyl-4-phenylpyridinium (EXP) N-nitrosodiethylamine (ISO) N-tosyl-L-phenylalanyl chloromethyl ketone (ISO) nickel atom (ISO) nicotine (ISO) ochratoxin A (ISO) ozone (EXP,ISO) paracetamol (ISO) paraquat (ISO) parathion (ISO) paroxetine (ISO) pentachlorophenol (ISO) phenytoin (ISO) phorbol 13-acetate 12-myristate (ISO) phosmet (ISO) phytoestrogen (ISO) piperonyl butoxide (ISO) pirinixic acid (ISO) platycodin D (ISO) poly(I:C) (ISO) prednisolone (ISO) prednisone (ISO) procymidone (ISO) progesterone (ISO) propionic acid (ISO) pyrrolidine dithiocarbamate (ISO) pyrvinium (EXP) resveratrol (ISO) Rhein (ISO) rosmarinic acid (ISO) rutin (ISO) ruxolitinib (ISO) S-butyl-DL-homocysteine (S,R)-sulfoximine (ISO) SB 203580 (ISO) SB-239063 (ISO) silicon dioxide (ISO) simvastatin (ISO) sirolimus (ISO) sodium arsenate (ISO) sodium arsenite (EXP,ISO) sodium dodecyl sulfate (ISO) sodium fluoride (ISO) sodium taurocholate (EXP) streptozocin (EXP) strophanthidin (ISO) sulfasalazine (EXP) sulfur dioxide (ISO) tamibarotene (ISO) tetrachloromethane (ISO) tetraconazole (ISO) thymoquinone (EXP) titanium dioxide (ISO) tofacitinib (ISO) toluene 2,4-diisocyanate (ISO) tributyrin (ISO) trichloroethene (ISO) triflumizole (ISO) Triptolide (ISO) Tryptanthrine (ISO) vitamin K (EXP) wogonin (ISO) wortmannin (ISO)
Biological Process
adaptive immune response (IEA) cellular response to glucocorticoid stimulus (IMP) cellular response to interleukin-1 (IEA,ISO) defense response to fungus (IEA,ISO) defense response to Gram-negative bacterium (IEA,ISO) defense response to Gram-positive bacterium (IEA,ISO) fibroblast activation (IEA,ISO) gene expression (IEA,ISO) granulocyte migration (IEA,ISO) immune system process (IEA) inflammatory response (IEA) innate immune response (IEA) interleukin-17-mediated signaling pathway (IEA,ISO) interleukin-17A-mediated signaling pathway (IEA,ISO) intestinal epithelial structure maintenance (IEA,ISO) keratinocyte differentiation (IEA,ISO) keratinocyte proliferation (IEA,ISO) mRNA stabilization (ISO) negative regulation of inflammatory response to wounding (IEA,ISO) Notch signaling pathway (IEA,ISO) positive regulation of antimicrobial peptide production (IEA,ISO) positive regulation of bicellular tight junction assembly (IEA,ISO) positive regulation of cellular process (IDA) positive regulation of chemokine (C-X-C motif) ligand 1 production (IEA,ISO) positive regulation of cytokine production involved in inflammatory response (IEA,ISO) positive regulation of interleukin-1 beta production (IEA,ISO) positive regulation of interleukin-12 production (IEA,ISO) positive regulation of interleukin-16 production (IEA,ISO) positive regulation of interleukin-23 production (IEA,ISO) positive regulation of interleukin-6 production (IEA,ISO) positive regulation of osteoclast differentiation (IEA,ISO) positive regulation of transcription by RNA polymerase II (IDA,IEA,ISO) positive regulation of tumor necrosis factor production (IEA,ISO) response to amino acid (IEP) response to wounding (IEA,ISO)
1.
IL-17A gene transfer induces bone loss and epidermal hyperplasia associated with psoriatic arthritis.
Adamopoulos IE, etal., Ann Rheum Dis. 2014 Feb 23. doi: 10.1136/annrheumdis-2013-204782.
2.
Propionibacterium acnes Induces an IL-17 Response in Acne Vulgaris that Is Regulated by Vitamin A and Vitamin D.
Agak GW, etal., J Invest Dermatol. 2014 Feb;134(2):366-73. doi: 10.1038/jid.2013.334. Epub 2013 Aug 7.
3.
Proteomic analysis indicates altered expression of plasma proteins in a rat nephropathy model.
Ai S, etal., Clin Exp Nephrol. 2013 Feb;17(1):24-31. doi: 10.1007/s10157-012-0662-y. Epub 2012 Jul 7.
4.
IL-17A levels increase in the infarcted region of the left ventricle in a rat model of myocardial infarction.
Avalos AM, etal., Biol Res. 2012;45(2):193-200. doi: 10.4067/S0716-97602012000200012.
5.
Interleukin-17A expression in patients presenting with nasal polyposis.
Avelino MA, etal., Braz J Otorhinolaryngol. 2013 Sep-Oct;79(5):616-9. doi: 10.5935/1808-8694.20130110.
6.
Anti-interleukin-17A monoclonal antibody secukinumab in treatment of ankylosing spondylitis: a randomised, double-blind, placebo-controlled trial.
Baeten D, etal., Lancet. 2013 Nov 23;382(9906):1705-13. doi: 10.1016/S0140-6736(13)61134-4. Epub 2013 Sep 13.
7.
IL-17/Th17 promotes type 1 T cell immunity against pulmonary intracellular bacterial infection through modulating dendritic cell function.
Bai H, etal., J Immunol. 2009 Nov 1;183(9):5886-95. Epub 2009 Oct 7.
8.
Interleukin-17 in sputum correlates with airway hyperresponsiveness to methacholine.
Barczyk A, etal., Respir Med. 2003 Jun;97(6):726-33.
9.
Enhanced IL-17 signalling following myocardial ischaemia/reperfusion injury.
Barry SP, etal., Int J Cardiol. 2013 Mar 10;163(3):326-34. doi: 10.1016/j.ijcard.2011.08.849. Epub 2011 Oct 24.
10.
IL-17 producing gammadelta T cells are required for a controlled inflammatory response after bleomycin-induced lung injury.
Braun RK, etal., Inflammation. 2008 Jun;31(3):167-79. Epub 2008 Mar 13.
11.
Raised interleukin-17 is immuno-localised to neutrophils in cystic fibrosis lung disease.
Brodlie M, etal., Eur Respir J. 2010 Nov 25.
12.
Active trachoma is associated with increased conjunctival expression of IL17A and profibrotic cytokines.
Burton MJ, etal., Infect Immun. 2011 Dec;79(12):4977-83. doi: 10.1128/IAI.05718-11. Epub 2011 Sep 12.
13.
Alteration of IL-17 related protein expressions in experimental autoimmune myocarditis and inhibition of IL-17 by IL-10-Ig fusion gene transfer.
Chang H, etal., Circ J. 2008 May;72(5):813-9.
14.
Anti-IL-17A therapy protects against bone erosion in experimental models of rheumatoid arthritis.
Chao CC, etal., Autoimmunity. 2010 Oct 7.
15.
The polymorphism of IL-17 G-152A was associated with childhood asthma and bacterial colonization of the hypopharynx in bronchiolitis.
Chen J, etal., J Clin Immunol. 2010 Jul;30(4):539-45. Epub 2010 May 2.
16.
Decreasing TNF-alpha results in less fibrosis and earlier resolution of granulomatous experimental autoimmune thyroiditis.
Chen K, etal., J Leukoc Biol. 2007 Jan;81(1):306-14. Epub 2006 Oct 17.
17.
Inhibition of IL-17A in atherosclerosis.
Cheng X, etal., Atherosclerosis. 2011 Apr;215(2):471-4. doi: 10.1016/j.atherosclerosis.2010.12.034. Epub 2011 Jan 19.
18.
Role of group 3 innate lymphoid cells during experimental otitis media in a rat model.
Cho CG, etal., Int J Pediatr Otorhinolaryngol. 2016 Sep;88:146-52. doi: 10.1016/j.ijporl.2016.07.001. Epub 2016 Jul 6.
19.
The nature of innate and adaptive interleukin-17A responses in sham or bacterial inoculation.
Chong DL, etal., Immunology. 2012 Jul;136(3):325-33. doi: 10.1111/j.1365-2567.2012.03584.x.
20.
Transcriptomic and Innate Immune Responses to Yersinia pestis in the Lymph Node during Bubonic Plague.
Comer JE, etal., Infect Immun. 2010 Dec;78(12):5086-5098. Epub 2010 Sep 27.
21.
Critical role of IL-17RA in immunopathology of influenza infection.
Crowe CR, etal., J Immunol. 2009 Oct 15;183(8):5301-10. Epub 2009 Sep 25.
22.
Decreased RNA expression of interleukin 17A in skin of leprosy.
da Motta-Passos I, etal., Eur J Dermatol. 2012 Jul-Aug;22(4):488-94. doi: 10.1684/ejd.2012.1741.
23.
Interleukins 17 and 23 influence the host response to Histoplasma capsulatum.
Deepe GS Jr and Gibbons RS, J Infect Dis. 2009 Jul 1;200(1):142-51. doi: 10.1086/599333.
24.
T helper type 17-related cytokine expression is increased in the bronchial mucosa of stable chronic obstructive pulmonary disease patients.
Di Stefano A, etal., Clin Exp Immunol. 2009 Aug;157(2):316-24.
25.
Regulatory T cell activity is partly inhibited in a mouse model of chronic Pseudomonas aeruginosa lung infection.
Ding FM, etal., Exp Lung Res. 2015 Feb;41(1):44-55. doi: 10.3109/01902148.2014.964351. Epub 2014 Nov 14.
26.
[The expression of interleukin-17 in blood and nasal tissue of patients with allergic rhinltis and nasal polyps]
Du JT, etal., Sichuan Da Xue Xue Bao Yi Xue Ban. 2010 Mar;41(2):235-8.
27.
Effect of systemic inflammation on inspiratory and limb muscle strength and bulk in cystic fibrosis.
Dufresne V, etal., Am J Respir Crit Care Med. 2009 Jul 15;180(2):153-8. Epub 2009 Apr 2.
28.
Increased IL-17A expression in temporal artery lesions is a predictor of sustained response to glucocorticoid treatment in patients with giant-cell arteritis.
Espigol-Frigole G, etal., Ann Rheum Dis. 2013 Sep 1;72(9):1481-7. doi: 10.1136/annrheumdis-2012-201836. Epub 2012 Sep 19.
29.
Amelioration of experimental autoimmune uveitis by leflunomide in Lewis rats.
Fang CB, etal., PLoS One. 2013 Apr 23;8(4):e62071. doi: 10.1371/journal.pone.0062071. Print 2013.
30.
IL-22 mRNA in peripheral blood mononuclear cells from allergic rhinitic and asthmatic pediatric patients.
Farfariello V, etal., Pediatr Allergy Immunol. 2011 Jun;22(4):419-23. doi: 10.1111/j.1399-3038.2010.01116.x.
31.
Bone marrow derived-mesenchymal stem cells downregulate IL17A dependent IL6/STAT3 signaling pathway in CCl4-induced rat liver fibrosis.
Farouk S, etal., PLoS One. 2018 Oct 22;13(10):e0206130. doi: 10.1371/journal.pone.0206130. eCollection 2018.
32.
The study of ISO induced heart failure rat model.
Feng W and Li W, Exp Mol Pathol. 2010 Apr;88(2):299-304. Epub 2009 Nov 10.
33.
IL-17 induces myocardial fibrosis and enhances RANKL/OPG and MMP/TIMP signaling in isoproterenol-induced heart failure.
Feng W, etal., Exp Mol Pathol. 2009 Dec;87(3):212-8. Epub 2009 Jun 13.
34.
Proinflammatory Th17 cells are expanded and induced by dendritic cells in spondylarthritis-prone HLA-B27-transgenic rats.
Glatigny S, etal., Arthritis Rheum. 2012 Jan;64(1):110-20. doi: 10.1002/art.33321.
35.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
36.
Interleukin-17 promotes early allograft inflammation.
Gorbacheva V, etal., Am J Pathol. 2010 Sep;177(3):1265-73. doi: 10.2353/ajpath.2010.091106. Epub 2010 Jul 22.
37.
Clinical aspects and cytokine response in severe H1N1 influenza A virus infection.
Hagau N, etal., Crit Care. 2010;14(6):R203. Epub 2010 Nov 9.
38.
Tc17, a unique subset of CD8 T cells that can protect against lethal influenza challenge.
Hamada H, etal., J Immunol. 2009 Mar 15;182(6):3469-81.
39.
Expression of Th-17 and RORgammat mRNA in Behcet's Disease.
Hamzaoui K, etal., Med Sci Monit. 2011 Apr;17(4):CR227-34.
40.
Chlamydial respiratory infection during allergen sensitization drives neutrophilic allergic airways disease.
Horvat JC, etal., J Immunol. 2010 Apr 15;184(8):4159-69. Epub 2010 Mar 12.
41.
Methotrexate ameliorates pristane-induced arthritis by decreasing IFN-gamma and IL-17A expressions.
Hou WK, etal., J Zhejiang Univ Sci B. 2011 Jan;12(1):40-6. doi: 10.1631/jzus.B1000078.
42.
Neuroprotection effect of interleukin (IL)-17 secreted by reactive astrocytes is emerged from a high-level IL-17-containing environment during acute neuroinflammation.
Hu MH, etal., Clin Exp Immunol. 2014 Feb;175(2):268-84. doi: 10.1111/cei.12219.
43.
Interleukin-17A expression in patients with chronic rhinosinusitis and its relationship with clinical features.
Hu XD, etal., J Int Med Res. 2013 Jun;41(3):777-84. doi: 10.1177/0300060513478089. Epub 2013 Apr 18.
44.
Clinical features of patients infected with 2019 novel coronavirus in Wuhan, China.
Huang C, etal., Lancet. 2020 Feb 15;395(10223):497-506. doi: 10.1016/S0140-6736(20)30183-5. Epub 2020 Jan 24.
45.
[IL-17A promotes pulmonary inflammation in rats with pulmonary fibrosis induced by bleomycin].
Huang C, etal., Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2014 Apr;30(4):366-70.
46.
Effects of AIN457, a fully human antibody to interleukin-17A, on psoriasis, rheumatoid arthritis, and uveitis.
Hueber W, etal., Sci Transl Med. 2010 Oct 6;2(52):52ra72. doi: 10.1126/scitranslmed.3001107.
47.
Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
Janssen R, etal., J Infect Dis. 2007 Sep 15;196(6):826-34. Epub 2007 Aug 10.
48.
Coordinated gene expression of Th17- and Treg-associated molecules correlated with resolution of the monophasic experimental autoimmune uveitis.
Jia X, etal., Mol Vis. 2011;17:1493-507. Epub 2011 Jun 7.
49.
Keratinocyte overexpression of IL-17C promotes psoriasiform skin inflammation.
Johnston A, etal., J Immunol. 2013 Mar 1;190(5):2252-62. doi: 10.4049/jimmunol.1201505. Epub 2013 Jan 28.
50.
Interleukin-17-mediated immunopathogenesis in experimental hypersensitivity pneumonitis.
Joshi AD, etal., Am J Respir Crit Care Med. 2009 Apr 15;179(8):705-16. Epub 2009 Jan 16.
51.
Circulatory levels of T-cell cytokines (interleukin -2, IL-4, IL-17, and transforming growth factor-beta) in patients with vitiligo.
Khan R, etal., J Am Acad Dermatol. 2012 Mar;66(3):510-1. doi: 10.1016/j.jaad.2011.07.018.
52.
Possible pathogenic role of Th17 cells for atopic dermatitis.
Koga C, etal., J Invest Dermatol. 2008 Nov;128(11):2625-30. doi: 10.1038/jid.2008.111. Epub 2008 Apr 24.
53.
IL-17 plays an important role in the development of experimental autoimmune encephalomyelitis.
Komiyama Y, etal., J Immunol. 2006 Jul 1;177(1):566-73.
54.
Impaired immune response in severe human lower tract respiratory infection by respiratory syncytial virus.
Larranaga CL, etal., Pediatr Infect Dis J. 2009 Oct;28(10):867-73.
55.
Role of IL-1 beta in the development of human T(H)17 cells: lesson from NLPR3 mutated patients.
Lasiglie D, etal., PLoS One. 2011;6(5):e20014. doi: 10.1371/journal.pone.0020014. Epub 2011 May 26.
56.
Expression of interleukin-17 in ischemic brain tissue.
Li GZ, etal., Scand J Immunol. 2005 Nov;62(5):481-6.
57.
Susceptibility to pulmonary disease due to Mycobacterium avium-intracellulare complex may reflect low IL-17 and high IL-10 responses rather than Th1 deficiency.
Lim A, etal., Clin Immunol. 2010 Nov;137(2):296-302. Epub 2010 Aug 24.
58.
Complement component C5a promotes expression of IL-22 and IL-17 from human T cells and its implication in age-related macular degeneration.
Liu B, etal., J Transl Med. 2011 Jul 15;9:1-12. doi: 10.1186/1479-5876-9-111.
59.
Forkhead box P3(+) T cells express interleukin-17 in nasal mucosa of patients with both allergic rhinitis and polyposis.
Liu T, etal., Clin Exp Immunol. 2010 Nov 22. doi: 10.1111/j.1365-2249.2010.04278.x.
60.
IL-17A-producing gammadelta T and Th17 lymphocytes mediate lung inflammation but not fibrosis in experimental silicosis.
Lo Re S, etal., J Immunol. 2010 Jun 1;184(11):6367-77. Epub 2010 Apr 26.
61.
Bovine glycomacropeptide has intestinal antiinflammatory effects in rats with dextran sulfate-induced colitis.
Lopez-Posadas R, etal., J Nutr. 2010 Nov;140(11):2014-9. Epub 2010 Sep 29.
62.
Morphine disrupts interleukin-23 (IL-23)/IL-17-mediated pulmonary mucosal host defense against Streptococcus pneumoniae infection.
Ma J, etal., Infect Immun. 2010 Feb;78(2):830-7. Epub 2009 Dec 7.
63.
Interleukin-17A Exacerbates Ferric Chloride-Induced Arterial Thrombosis in Rat Carotid Artery.
Maione F, etal., Int J Inflam. 2014;2014:247503. doi: 10.1155/2014/247503. Epub 2014 Apr 3.
64.
The involvement of IL-17A in the murine response to sub-lethal inhalational infection with Francisella tularensis.
Markel G, etal., PLoS One. 2010 Jun 18;5(6):e11176.
65.
Strain difference in susceptibility to experimental autoimmune encephalomyelitis in rats correlates with T(H)1 and T(H)17-inducing cytokine profiles.
Markovic M, etal., Mol Immunol. 2009 Nov;47(1):141-6. Epub 2009 Feb 23.
66.
Influence of the IL17A locus in giant cell arteritis susceptibility.
Marquez A, etal., Ann Rheum Dis. 2014 Sep;73(9):1742-5. doi: 10.1136/annrheumdis-2014-205261. Epub 2014 Jun 11.
67.
Efficacy and safety of secukinumab, a fully human anti-interleukin-17A monoclonal antibody, in patients with moderate-to-severe psoriatic arthritis: a 24-week, randomised, double-blind, placebo-controlled, phase II proof-of-concept trial.
McInnes IB, etal., Ann Rheum Dis. 2014 Feb;73(2):349-56. doi: 10.1136/annrheumdis-2012-202646. Epub 2013 Jan 29.
68.
Spinal interleukin-17 promotes thermal hyperalgesia and NMDA NR1 phosphorylation in an inflammatory pain rat model.
Meng X, etal., Pain. 2013 Feb;154(2):294-305. doi: 10.1016/j.pain.2012.10.022. Epub 2012 Nov 5.
69.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
70.
Methylprednisolone inhibits IFN-gamma and IL-17 expression and production by cells infiltrating central nervous system in experimental autoimmune encephalomyelitis.
Miljkovic Z, etal., J Neuroinflammation. 2009 Dec 11;6:37.
71.
Protective immunity against recurrent Staphylococcus aureus skin infection requires antibody and interleukin-17A.
Montgomery CP, etal., Infect Immun. 2014 May;82(5):2125-34. doi: 10.1128/IAI.01491-14. Epub 2014 Mar 10.
72.
Resolution of allergic airway inflammation and airway hyperreactivity is mediated by IL-17-producing {gamma}{delta}T cells.
Murdoch JR and Lloyd CM, Am J Respir Crit Care Med. 2010 Aug 15;182(4):464-76. Epub 2010 Apr 22.
73.
Increased Th17 functions are accompanied by Tregs activities in lupoid leishmaniasis.
Nabavi NS, etal., Parasite Immunol. 2018 Jan;40(1). doi: 10.1111/pim.12507. Epub 2017 Dec 17.
74.
Local IL-17 production and a decrease in peripheral blood regulatory T cells in an animal model of bronchiolitis obliterans.
Nakagiri T, etal., Transplantation. 2010 Jun 15;89(11):1312-9.
75.
Pathogenic effect of interleukin-17A in induction of Sjogren's syndrome-like disease using adenovirus-mediated gene transfer.
Nguyen CQ, etal., Arthritis Res Ther. 2010;12(6):R220. doi: 10.1186/ar3207. Epub 2010 Dec 23.
76.
Involvement of interleukin-17A in pancreatic damage in rat experimental acute necrotizing pancreatitis.
Ni J, etal., Inflammation. 2013 Feb;36(1):53-65. doi: 10.1007/s10753-012-9519-5.
77.
Neutralization of interleukin-17 aggravates dextran sulfate sodium-induced colitis in mice.
Ogawa A, etal., Clin Immunol. 2004 Jan;110(1):55-62.
78.
Potential roles of interleukin-17A in the development of skin fibrosis in mice.
Okamoto Y, etal., Arthritis Rheum. 2012 Nov;64(11):3726-35. doi: 10.1002/art.34643.
79.
A distinct lineage of CD4 T cells regulates tissue inflammation by producing interleukin 17.
Park H, etal., Nat Immunol. 2005 Nov;6(11):1133-41. Epub 2005 Oct 2.
80.
Phosphoinositide 3-kinase {delta} inhibitor suppresses IL-17 expression in a murine asthma model.
Park SJ, etal., Eur Respir J. 2010 Mar 29.
81.
Enhancement of acute phase and inhibition of chronic phase of experimental autoimmune neuritis in Lewis rats by intranasal administration of recombinant mouse interleukin 17: potential immunoregulatory role.
Pelidou SH, etal., Exp Neurol. 2000 May;163(1):165-72.
82.
IL-17 is a critical component of vaccine-induced protection against lung infection by lipopolysaccharide-heterologous strains of Pseudomonas aeruginosa.
Priebe GP, etal., J Immunol. 2008 Oct 1;181(7):4965-75.
83.
Effect of simvastatin on expression of IL17, HMGB1 and TLR4 in LN kidney tissues of rats.
Qin Y, etal., Asian Pac J Trop Med. 2014 Oct;7(10):792-5. doi: 10.1016/S1995-7645(14)60138-3.
84.
Application quantitative proteomics approach to identify differentially expressed proteins associated with cardiac protection mediated by cycloastragenol in acute myocardial infarction rats.
Ren YS, etal., J Proteomics. 2020 Jun 30;222:103691. doi: 10.1016/j.jprot.2020.103691. Epub 2020 Feb 14.
85.
Bovine glycomacropeptide ameliorates experimental rat ileitis by mechanisms involving downregulation of interleukin 17.
Requena P, etal., Br J Pharmacol. 2008 Jun;154(4):825-32. Epub 2008 Apr 21.
86.
GOA pipeline
RGD automated data pipeline
87.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
88.
Comprehensive gene review and curation
RGD comprehensive gene curation
89.
CpG oligodeoxynucleotide protection in polymicrobial sepsis is dependent on interleukin-17.
Rice L, etal., J Infect Dis. 2005 Apr 15;191(8):1368-76. Epub 2005 Mar 3.
90.
Interleukin-17 sensitizes joint nociceptors to mechanical stimuli and contributes to arthritic pain through neuronal interleukin-17 receptors in rodents.
Richter F, etal., Arthritis Rheum. 2012 Dec;64(12):4125-34. doi: 10.1002/art.37695.
91.
IL-23-mediated psoriasis-like epidermal hyperplasia is dependent on IL-17A.
Rizzo HL, etal., J Immunol. 2011 Feb 1;186(3):1495-502. doi: 10.4049/jimmunol.1001001. Epub 2010 Dec 20.
92.
Systemic neutralization of IL-17A significantly reduces breast cancer associated metastasis in arthritic mice by reducing CXCL12/SDF-1 expression in the metastatic niches.
Roy LD, etal., BMC Cancer. 2014 Mar 27;14:225. doi: 10.1186/1471-2407-14-225.
93.
Role of interleukin-17A in the eosinophil accumulation and mucosal remodeling in chronic rhinosinusitis with nasal polyps associated with asthma.
Saitoh T, etal., Int Arch Allergy Immunol. 2010;151(1):8-16. Epub 2009 Aug 6.
94.
Interleukin 17A as an effective target for anti-inflammatory and antiparasitic treatment of toxoplasmic uveitis.
Sauer A, etal., J Infect Dis. 2012 Oct;206(8):1319-29. Epub 2012 Aug 22.
95.
Interleukin 17 and RANTES levels in induced sputum of patients with allergic rhinitis after a single nasal allergen challenge.
Semik-Orzech A, etal., Ann Allergy Asthma Immunol. 2009 Nov;103(5):418-24.
96.
[The changes and significance of interleukin-17 in rat models of chronic obstructive pulmonary disease and asthma].
Shen F, etal., Zhonghua Jie He He Hu Xi Za Zhi. 2004 Oct;27(10):654-8.
97.
[The levels and clinical implications of induced sputum interleukin-17 in chronic obstructive pulmonary disease and asthma]
Shen F, etal., Zhonghua Nei Ke Za Zhi. 2004 Dec;43(12):888-90.
98.
Elevated levels of interleukin-27 and effect on production of interferon-gamma and interleukin-17 in patients with Behcet's disease.
Shen H, etal., Scand J Rheumatol. 2013;42(1):48-51. doi: 10.3109/03009742.2012.704391. Epub 2012 Oct 26.
99.
Sequential IL-23 and IL-17 and increased Mmp8 and Mmp14 expression characterize the progression of an experimental model of periodontal disease in type 1 diabetes.
Silva JA, etal., J Cell Physiol. 2012 Jun;227(6):2441-50. doi: 10.1002/jcp.22979.
100.
IL-17-producing alveolar macrophages mediate allergic lung inflammation related to asthma.
Song C, etal., J Immunol. 2008 Nov 1;181(9):6117-24.
101.
BF02, a recombinant TNFR2 fusion protein, alleviates adjuvant arthritis by regulating T lymphocytes in rats.
Song SS, etal., Acta Pharmacol Sin. 2013 Mar;34(3):414-23. doi: 10.1038/aps.2012.171. Epub 2013 Feb 4.
102.
Pathological versus protective functions of IL-22 in airway inflammation are regulated by IL-17A.
Sonnenberg GF, etal., J Exp Med. 2010 Jun 7;207(6):1293-305. Epub 2010 May 24.
103.
A comparison of the effects of topical treatment of calcipotriol, camptothecin, clobetasol and tazarotene on an imiquimod-induced psoriasis-like mouse model.
Sun J, etal., Immunopharmacol Immunotoxicol. 2014 Feb;36(1):17-24. doi: 10.3109/08923973.2013.862542. Epub 2013 Nov 29.
104.
IL-17A differentially regulates corneal vascular endothelial growth factor (VEGF)-A and soluble VEGF receptor 1 expression and promotes corneal angiogenesis after herpes simplex virus infection.
Suryawanshi A, etal., J Immunol. 2012 Apr 1;188(7):3434-46. doi: 10.4049/jimmunol.1102602. Epub 2012 Feb 29.
105.
Therapeutic effects of human mesenchymal stem cells in Wistar-Kyoto rats with anti-glomerular basement membrane glomerulonephritis.
Suzuki T, etal., PLoS One. 2013 Jun 24;8(6):e67475. doi: 10.1371/journal.pone.0067475. Print 2013.
106.
IL-17 in cutaneous lupus erythematosus.
Tanasescu C, etal., Eur J Intern Med. 2010 Jun;21(3):202-7. doi: 10.1016/j.ejim.2010.03.004. Epub 2010 Apr 8.
107.
Interleukin-17A+ cell counts are increased in systemic sclerosis skin and their number is inversely correlated with the extent of skin involvement.
Truchetet ME, etal., Arthritis Rheum. 2013 May;65(5):1347-56. doi: 10.1002/art.37860.
108.
Anti-inflammation effects of corn silk in a rat model of carrageenin-induced pleurisy.
Wang GQ, etal., Inflammation. 2012 Jun;35(3):822-7.
109.
Association between polymorphisms in cytokine genes IL-17A and IL-17F and development of allergic rhinitis and comorbid asthma in Chinese subjects.
Wang M, etal., Hum Immunol. 2012 Jun;73(6):647-53. doi: 10.1016/j.humimm.2012.03.010. Epub 2012 Apr 13.
110.
Interleukin 17A promotes pneumococcal clearance by recruiting neutrophils and inducing apoptosis through a p38 mitogen-activated protein kinase-dependent mechanism in acute otitis media.
Wang W, etal., Infect Immun. 2014 Jun;82(6):2368-77. doi: 10.1128/IAI.00006-14. Epub 2014 Mar 24.
111.
[Measurement of eosinophils and interleukin-17 in nasopharyngeal secretions of children under 5 years old with wheezing]
Wang XF, etal., Zhongguo Dang Dai Er Ke Za Zhi. 2010 Feb;12(2):113-6.
112.
Neutrophils produce interleukin 17A (IL-17A) in a dectin-1- and IL-23-dependent manner during invasive fungal infection.
Werner JL, etal., Infect Immun. 2011 Oct;79(10):3966-77. doi: 10.1128/IAI.05493-11. Epub 2011 Aug 1.
113.
Bleomycin and IL-1beta-mediated pulmonary fibrosis is IL-17A dependent.
Wilson MS, etal., J Exp Med. 2010 Mar 15;207(3):535-52. Epub 2010 Feb 22.
114.
Th17 promotes acute rejection following liver transplantation in rats.
Xie XJ, etal., J Zhejiang Univ Sci B. 2010 Nov;11(11):819-27.
115.
Immunohistochemical localization of IL-17 in induced rat periapical lesions.
Xiong H, etal., J Endod. 2009 Feb;35(2):216-20. Epub 2008 Dec 13.
116.
Expression of interleukin-17 in lung and peripheral blood of asthmatic rats and the influence of dexamethasone.
Xiong W, etal., J Huazhong Univ Sci Technolog Med Sci. 2007 Oct;27(5):498-500.
117.
Association of interleukin-17A and -17F gene single-nucleotide polymorphisms with autoimmune thyroid diseases.
Yan N, etal., Autoimmunity. 2012 Nov;45(7):533-9. doi: 10.3109/08916934.2012.702814. Epub 2012 Aug 17.
118.
Interleukin-17 plays a critical role in the acute rejection of intestinal transplantation.
Yang JJ, etal., World J Gastroenterol. 2013 Feb 7;19(5):682-91. doi: 10.3748/wjg.v19.i5.682.
119.
Effects of supplemental dietary arginine on the exogenous advanced glycosylation end product-induced interleukin-23/interleukin-17 immune response in rats.
Yeh CL, etal., Nutrition. 2012 Oct;28(10):1063-7. doi: 10.1016/j.nut.2012.01.014. Epub 2012 Jun 5.
120.
Epicutaneous exposure to staphylococcal superantigen enterotoxin B enhances allergic lung inflammation via an IL-17A dependent mechanism.
Yu J, etal., PLoS One. 2012;7(7):e39032. doi: 10.1371/journal.pone.0039032. Epub 2012 Jul 27.
121.
The Treg/Th17 imbalance in Toxoplasma gondii-infected pregnant mice.
Zhang H, etal., Am J Reprod Immunol. 2012 Feb;67(2):112-21. doi: 10.1111/j.1600-0897.2011.01065.x. Epub 2011 Sep 19.
122.
Potassium channel changes of peripheral blood T-lymphocytes from Kazakh hypertensive patients in Northwest China and the inhibition effect towards potassium channels by telmisartan.
Zhang Q, etal., Kardiol Pol. 2016;74(5):476-488. doi: 10.5603/KP.a2015.0210. Epub 2015 Oct 27.
123.
Suppression of experimental autoimmune uveoretinitis by Anti-IL-17 antibody.
Zhang R, etal., Curr Eye Res. 2009 Apr;34(4):297-303.
124.
Genetic Variants of Interleukin 17A Are Functionally Associated with Increased Risk of Age-Related Macular Degeneration.
Zhang S, etal., Inflammation. 2014 Jul 16.
125.
Protective effects of losartan in mice with chronic viral myocarditis induced by coxsackievirus B3.
Zhang YY, etal., Life Sci. 2013 Jul 10;92(24-26):1186-94. doi: 10.1016/j.lfs.2013.05.010. Epub 2013 May 20.
126.
EGFR signaling blunts allergen-induced IL-6 production and Th17 responses in the skin and attenuates development and relapse of atopic dermatitis.
Zhang Z, etal., J Immunol. 2014 Feb 1;192(3):859-66. doi: 10.4049/jimmunol.1301062. Epub 2013 Dec 13.
127.
FTY720 attenuates lesional interleukin-17(+) cell accumulation in rat experimental autoimmune neuritis.
Zhang ZY, etal., Neuropathol Appl Neurobiol. 2009 Oct;35(5):487-95. Epub 2009 Feb 4.
128.
Indoleamine 2,3-dioxygenase 1 deficiency attenuates CCl4-induced fibrosis through Th17 cells down-regulation and tryptophan 2,3-dioxygenase compensation.
Zhong W, etal., Oncotarget. 2017 Jun 20;8(25):40486-40500. doi: 10.18632/oncotarget.17119.
129.
The microRNA miR-23b suppresses IL-17-associated autoimmune inflammation by targeting TAB2, TAB3 and IKK-α.
Zhu S, etal., Nat Med. 2012 Jul;18(7):1077-86. doi: 10.1038/nm.2815.
Il17a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 9 30,640,844 - 30,644,331 (+) NCBI GRCr8 mRatBN7.2 9 23,144,402 - 23,147,889 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 9 23,144,402 - 23,147,889 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 9 31,641,574 - 31,645,060 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 9 36,762,293 - 36,765,779 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 9 35,077,566 - 35,081,052 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 9 26,841,299 - 26,844,786 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 9 26,841,299 - 26,844,786 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 9 25,696,865 - 25,700,352 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 9 19,454,979 - 19,458,467 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 9 19,453,469 - 19,455,797 (+) NCBI Celera 9 20,720,899 - 20,724,386 (+) NCBI Celera Cytogenetic Map 9 q13 NCBI
IL17A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 6 52,186,375 - 52,190,638 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 6 52,186,375 - 52,190,638 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 6 52,051,173 - 52,055,436 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 6 52,159,144 - 52,163,395 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 6 52,159,143 - 52,163,395 NCBI Celera 6 53,712,308 - 53,716,559 (+) NCBI Celera Cytogenetic Map 6 p12.2 NCBI HuRef 6 51,882,254 - 51,886,505 (+) NCBI HuRef CHM1_1 6 52,053,438 - 52,057,689 (+) NCBI CHM1_1 T2T-CHM13v2.0 6 52,025,075 - 52,029,336 (+) NCBI T2T-CHM13v2.0
Il17a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 1 20,801,129 - 20,804,720 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 1 20,801,129 - 20,804,720 (+) Ensembl GRCm39 Ensembl GRCm38 1 20,730,905 - 20,734,496 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 1 20,730,905 - 20,734,496 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 1 20,720,986 - 20,724,577 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 1 20,716,056 - 20,719,647 (+) NCBI MGSCv36 mm8 Celera 1 20,604,456 - 20,608,046 (+) NCBI Celera Cytogenetic Map 1 A4 NCBI cM Map 1 6.45 NCBI
Il17a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955411 5,896,702 - 5,900,962 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955411 5,896,435 - 5,899,911 (-) NCBI ChiLan1.0 ChiLan1.0
IL17A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 5 66,651,896 - 66,656,165 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 6 62,528,730 - 62,532,997 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 6 51,736,269 - 51,740,538 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 6 53,004,820 - 53,009,074 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 6 53,004,820 - 53,009,074 (+) Ensembl panpan1.1 panPan2
IL17A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 12 19,854,129 - 19,862,521 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 12 19,854,129 - 19,862,513 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 12 19,751,596 - 19,759,988 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 12 20,353,311 - 20,361,254 (+) NCBI ROS_Cfam_1.0 UMICH_Zoey_3.1 12 19,859,850 - 19,868,228 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 12 19,962,726 - 19,971,118 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 12 20,100,900 - 20,109,292 (+) NCBI UU_Cfam_GSD_1.0
Il17a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404946 55,335,194 - 55,338,342 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936476 8,621,860 - 8,625,008 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936476 8,621,860 - 8,625,008 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
IL17A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 7 46,013,584 - 46,017,153 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 7 46,013,584 - 46,017,161 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 7 52,463,736 - 52,467,313 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
IL17A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 17 20,314,082 - 20,319,917 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 17 20,315,773 - 20,318,785 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666044 52,087,244 - 52,091,712 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Il17a
.
Assembly: mRatBN7.2 Assembly: Rnor_5.0 Assembly: Rnor_6.0
Predicted Target Of
Count of predictions: 52 Count of miRNA genes: 43 Interacting mature miRNAs: 51 Transcripts: ENSRNOT00000016664 Prediction methods: Miranda, Targetscan Result types: miRGate_prediction
631211 Bw4 Body weight QTL4 5.31 retroperitoneal fat pad mass (VT:0010430) retroperitoneal fat pad weight to body weight ratio (CMO:0000635) 9 5109826 50109826 Rat 2303559 Gluco54 Glucose level QTL 54 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 9 1254084 46254084 Rat 7411609 Foco16 Food consumption QTL 16 25.6 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 8952560 53952560 Rat 631680 Cm11 Cardiac mass QTL 11 3.1 0.00089 heart left ventricle mass (VT:0007031) heart left ventricle weight to body weight ratio (CMO:0000530) 9 20430519 65430519 Rat 70186 Niddm26 Non-insulin dependent diabetes mellitus QTL 26 3.87 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 9 22071169 86369743 Rat 9589055 Scfw5 Subcutaneous fat weight QTL 5 5.55 0.001 subcutaneous adipose mass (VT:1000472) abdominal subcutaneous fat pad weight (CMO:0002069) 9 1 37999212 Rat 1641911 Alcrsp13 Alcohol response QTL 13 response to alcohol trait (VT:0010489) brain neurotensin receptor 1 density (CMO:0002068) 9 1 43718459 Rat 1354650 Despr5 Despair related QTL 5 4.01 0.0017 locomotor behavior trait (VT:0001392) amount of time spent in voluntary immobility (CMO:0001043) 9 1254084 46254084 Rat 1300124 Cm4 Cardiac mass QTL 4 3.55 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 9 1 40594091 Rat 61425 Cia15 Collagen induced arthritis QTL 15 4.6 joint integrity trait (VT:0010548) joint inflammation composite score (CMO:0000919) 9 5109826 42921101 Rat 631643 Bp120 Blood pressure QTL 120 3 0.004 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 22071200 67071200 Rat 70226 Eae4 Experimental allergic encephalomyelitis QTL 4 nervous system integrity trait (VT:0010566) experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046) 9 1 25661317 Rat 9589158 Gluco65 Glucose level QTL 65 6.82 0.001 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 9 1 37999212 Rat 10054125 Srcrt7 Stress Responsive Cort QTL 7 3.33 0.0011 blood corticosterone amount (VT:0005345) plasma corticosterone level (CMO:0001173) 9 1 87073594 Rat 724543 Cm20 Cardiac mass QTL 20 3.9 heart mass (VT:0007028) calculated heart weight (CMO:0000073) 9 16961398 40594091 Rat 1600365 Mcs20 Mammary carcinoma susceptibility QTL 20 3 mammary gland integrity trait (VT:0010552) mammary tumor growth rate (CMO:0000344) 9 13533770 42791750 Rat 11353947 Bp392 Blood pressure QTL 392 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 9 7283252 52283252 Rat 7411592 Foco8 Food consumption QTL 8 7.4 0.001 eating behavior trait (VT:0001431) feed conversion ratio (CMO:0001312) 9 1 37999212 Rat 1331757 Cdexp1 CD45RC expression in CD8 T cells QTL 1 4.3 CD8-positive T cell quantity (VT:0008077) blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990) 9 1024537 67509080 Rat 1298088 Edpm11 Estrogen-dependent pituitary mass QTL 11 2.5 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 9 1 43718459 Rat 9589133 Insul26 Insulin level QTL 26 17.96 0.001 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 9 8952560 53952560 Rat 1598823 Memor16 Memory QTL 16 1.9 exploratory behavior trait (VT:0010471) difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678) 9 22133322 49968732 Rat
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
2
1
6
11
1
11
1
15
11
5
10
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000016664 ⟹ ENSRNOP00000016664
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 9 23,144,402 - 23,147,889 (+) Ensembl Rnor_6.0 Ensembl 9 26,841,299 - 26,844,786 (+) Ensembl
RefSeq Acc Id:
NM_001106897 ⟹ NP_001100367
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 9 30,640,844 - 30,644,331 (+) NCBI mRatBN7.2 9 23,144,402 - 23,147,889 (+) NCBI Rnor_6.0 9 26,841,299 - 26,844,786 (+) NCBI Rnor_5.0 9 25,696,865 - 25,700,352 (+) NCBI RGSC_v3.4 9 19,454,979 - 19,458,467 (+) RGD Celera 9 20,720,899 - 20,724,386 (+) RGD
Sequence:
CATCCACCTCACACGAGGCACAAGCTCATCCCGTACCAGCTGATCAGGACGAGCGACCATGAGTCCCCGGAGAATTCCATCCATGTGCCTGATGCTGTTGCTGCTACTGAACCTGGAGGCTACAGTGA
hide sequence
RefSeq Acc Id:
NP_001100367 ⟸ NM_001106897
- Peptide Label:
precursor
- UniProtKB:
Q61453 (UniProtKB/Swiss-Prot), A6JJ80 (UniProtKB/TrEMBL), G3V7M4 (UniProtKB/TrEMBL)
- Sequence:
MSPRRIPSMCLMLLLLLNLEATVKAAVLIPQSSVCPNAEANNFLQNVKVNLKVLNSLSSKASSRRPSDYLNRSTSPWTLSRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKRE
hide sequence
Ensembl Acc Id:
ENSRNOP00000016664 ⟸ ENSRNOT00000016664
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2011-05-26
Il17a
interleukin 17A
LOC301289
similar to Interleukin-17 precursor (IL-17) (Cytotoxic T lymphocyte-associated antigen 8) (CTLA-8)
Data merged from RGD:1587366
737654 APPROVED
2008-02-15
Il17a
interleukin 17A
Il17
interleukin 17
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2006-11-19
LOC301289
similar to Interleukin-17 precursor (IL-17) (Cytotoxic T lymphocyte-associated antigen 8) (CTLA-8)
Symbol and Name status set to provisional
70820 PROVISIONAL
2002-11-06
Il17
interleukin 17
Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
Name updated
625702 APPROVED
2002-06-10
Il17
Interleukin 17 (cytotoxic T-lymphocyte-associated serine esterase 8)
Symbol and Name status set to approved
70586 APPROVED
Note Type
Note
Reference
gene_expression
expressed in activated T cells
729041
gene_protein
150 amino acids
729041
