Sdhd (succinate dehydrogenase complex subunit D)

Gene: Sdhd (succinate dehydrogenase complex subunit D) Rattus norvegicus

Analyze

Symbol:

Sdhd

Name:

succinate dehydrogenase complex subunit D

RGD ID:

735231

Description:

Predicted to enable heme binding activity; succinate dehydrogenase (quinone) activity; and ubiquinone binding activity. Predicted to be involved in mitochondrial electron transport, succinate to ubiquinone and tricarboxylic acid cycle. Predicted to act upstream of or within cellular response to hypoxia and regulation of catecholamine secretion. Predicted to be located in mitochondrial inner membrane. Predicted to be part of mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone). Predicted to be active in mitochondrion. Human ortholog(s) of this gene implicated in Carney-Stratakis syndrome; mitochondrial complex II deficiency; and paraganglioma. Orthologous to human SDHD (succinate dehydrogenase complex subunit D); PARTICIPATES IN altered citric acid cycle pathway; citric acid cycle pathway; electron transport chain pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CII-4; cybS; MGC72971; QPs3; succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial; succinate dehydrogenase complex, subunit D, integral membrane protein; succinate-ubiquinone oxidoreductase cytochrome b small subunit; succinate-ubiquinone reductase membrane anchor subunit

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	59,841,090 - 59,850,641 (-)	NCBI		GRCr8
mRatBN7.2	8	50,944,702 - 50,954,298 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	50,944,704 - 50,954,238 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	56,450,402 - 56,459,946 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	54,729,300 - 54,738,844 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	52,593,576 - 52,603,120 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	55,028,125 - 55,037,604 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	55,028,125 - 55,037,604 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	53,625,447 - 53,634,926 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	53,955,067 - 53,964,547 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	53,974,120 - 53,983,601 (-)	NCBI
Celera	8	50,493,184 - 50,502,624 (-)	NCBI		Celera
Cytogenetic Map	8	q23	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

ataxia telangiectasia (ISO)

BH4-deficient hyperphenylalaninemia A (ISO)

Carney-Stratakis syndrome (ISO)

Carotid Body Tumor (ISO)

Chromosome 11, Partial Trisomy 11q (ISO)

combined oxidative phosphorylation deficiency 8 (ISO)

COVID-19 (ISO)

dilated cardiomyopathy 1II (ISO)

genetic disease (ISO)

Glomus Jugulare Tumor (ISO)

Hereditary Neoplastic Syndromes (ISO)

Hereditary Paraganglioma-Pheochromocytoma Syndromes (ISO)

intellectual disability (ISO)

Intestinal Carcinoid Tumors (ISO)

Islet Cell Tumor Syndrome (ISO)

melanoma (ISO)

microcephaly (ISO)

mitochondrial complex II deficiency (ISO)

Mitochondrial Complex II Deficiency Nuclear Type 1 (ISO)

Mitochondrial Complex II Deficiency Nuclear Type 3 (ISO)

paraganglioma (ISO)

Paragangliomas 1 (ISO)

Paragangliomas 3 (ISO)

Paragangliomas 4 (ISO)

Paragangliomas with Sensorineural Hearing Loss (ISO)

pheochromocytoma (ISO)

Pyruvate Dehydrogenase E2 Deficiency (ISO)

renal cell carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-dexrazoxane (ISO)

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4-chlorobiphenyl (ISO)

5-fluorouracil (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amiodarone (EXP)

amitrole (EXP)

antirheumatic drug (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

clofibrate (EXP)

clofibric acid (EXP)

clotrimazole (EXP)

cyclosporin A (ISO)

dexamethasone (ISO)

dichloromethane (ISO)

dicrotophos (ISO)

diquat (ISO)

doxorubicin (ISO)

folic acid (ISO)

gentamycin (EXP)

indometacin (EXP,ISO)

isoniazide (ISO)

L-ethionine (EXP)

Mesaconitine (EXP)

methimazole (EXP)

N-nitrosodiethylamine (EXP)

omeprazole (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (EXP)

rac-1,2-dichloropropane (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

toluene (EXP)

tungsten (ISO)

tunicamycin (ISO)

zidovudine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

cellular response to hypoxia (ISO)

mitochondrial electron transport, succinate to ubiquinone (IBA,IEA,NAS)

protein insertion into mitochondrial inner membrane (IEA)

proton motive force-driven mitochondrial ATP synthesis (NAS)

regulation of catecholamine secretion (ISO)

tricarboxylic acid cycle (IBA,IEA,ISO,NAS)

Cellular Component

mitochondrial inner membrane (IEA,ISO,ISS,NAS)

mitochondrial respiratory chain complex II, succinate dehydrogenase complex (ubiquinone) (IBA,IEA,ISO,ISS,NAS)

mitochondrion (ISO)

succinate dehydrogenase complex (ubiquinone) (ISO)

TIM22 mitochondrial import inner membrane insertion complex (IEA)

Molecular Function

heme binding (IBA,IEA,ISO,ISS)

metal ion binding (IEA)

protein binding (ISO)

protein transmembrane transporter activity (IEA)

succinate dehydrogenase (quinone) activity (IEA,ISO)

ubiquinone binding (IBA,IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

altered citric acid cycle pathway (ISO)

Alzheimer's disease pathway (IEA)

citric acid cycle pathway (IEA,ISO)

electron transport chain pathway (ISO)

fumaric aciduria pathway (ISO)

Huntington's disease pathway (IEA)

mitochondrial complex II deficiency pathway (ISO)

oxidative phosphorylation pathway (IEA)

Parkinson's disease pathway (IEA)

pyruvate dehydrogenase E2 deficiency pathway (ISO)

pyruvate dehydrogenase E3 deficiency pathway (ISO)

renal cell carcinoma pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	SDH mutations in cancer.	Bardella C, etal., Biochim Biophys Acta. 2011 Nov;1807(11):1432-43. doi: 10.1016/j.bbabio.2011.07.003. Epub 2011 Jul 13.
2.	Mutations in SDHD, a mitochondrial complex II gene, in hereditary paraganglioma.	Baysal BE, etal., Science 2000 Feb 4;287(5454):848-51.
3.	Succinate dehydrogenase deficiency in human.	Briere JJ, etal., Cell Mol Life Sci. 2005 Oct;62(19-20):2317-24.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Regulation of the hypoxia-dependent plasminogen activator inhibitor 1 expression by MAP kinases.	Kietzmann T, etal., Thromb Haemost. 2003 Apr;89(4):666-73.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Circadian gene expression of clock genes and plasminogen activator inhibitor-1 in heart and aorta of spontaneously hypertensive and Wistar-Kyoto rats.	Naito Y, etal., J Hypertens. 2003 Jun;21(6):1107-15.
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	The mitochondrial SDHD gene is required for early embryogenesis, and its partial deficiency results in persistent carotid body glomus cell activation with full responsiveness to hypoxia.	Piruat JI, etal., Mol Cell Biol. 2004 Dec;24(24):10933-40.
13.	GOA pipeline	RGD automated data pipeline
14.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
15.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
16.	Comprehensive gene review and curation	RGD comprehensive gene curation
17.	Assembly of mammalian oxidative phosphorylation complexes I-V and supercomplexes.	Signes A and Fernandez-Vizarra E, Essays Biochem. 2018 Jul 20;62(3):255-270. doi: 10.1042/EBC20170098. Print 2018 Jul 20.
18.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:9533030	PMID:14651853	PMID:15489334	PMID:15989954	PMID:16120479	PMID:17480203	PMID:18614015	PMID:19808025	PMID:26225774	PMID:31774353

Genomics

Comparative Map Data

Sdhd
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	59,841,090 - 59,850,641 (-)	NCBI		GRCr8
mRatBN7.2	8	50,944,702 - 50,954,298 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	50,944,704 - 50,954,238 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	56,450,402 - 56,459,946 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	54,729,300 - 54,738,844 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	52,593,576 - 52,603,120 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	55,028,125 - 55,037,604 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	55,028,125 - 55,037,604 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	53,625,447 - 53,634,926 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	53,955,067 - 53,964,547 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	53,974,120 - 53,983,601 (-)	NCBI
Celera	8	50,493,184 - 50,502,624 (-)	NCBI		Celera
Cytogenetic Map	8	q23	NCBI

SDHD
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	112,086,873 - 112,095,794 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	112,086,824 - 112,120,016 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	111,957,597 - 111,966,518 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	111,462,832 - 111,471,727 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	111,462,831 - 111,471,727	NCBI
Celera	11	109,110,763 - 109,119,710 (+)	NCBI		Celera
Cytogenetic Map	11	q23.1	NCBI
HuRef	11	107,881,580 - 107,890,557 (+)	NCBI		HuRef
CHM1_1	11	111,840,726 - 111,849,704 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	112,097,127 - 112,106,049 (+)	NCBI		T2T-CHM13v2.0

Sdhd
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	50,507,640 - 50,515,149 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	50,507,657 - 50,515,112 (-)	Ensembl		GRCm39 Ensembl
GRCm38	9	50,596,340 - 50,603,849 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	50,596,357 - 50,603,812 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	50,404,445 - 50,411,954 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	50,348,576 - 50,356,047 (-)	NCBI		MGSCv36	mm8
Celera	9	47,891,569 - 47,899,078 (-)	NCBI		Celera
Cytogenetic Map	9	A5.3	NCBI
cM Map	9	27.75	NCBI

Sdhd
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955412	13,768,501 - 13,778,932 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955412	13,768,501 - 13,778,944 (+)	NCBI	ChiLan1.0	ChiLan1.0

SDHD
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	21,030,295 - 21,041,125 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	20,952,816 - 20,963,688 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	21,053,488 - 21,064,559 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	21,053,492 - 21,064,493 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	21,115,095 - 21,126,173 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	21,015,331 - 21,026,183 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	21,063,761 - 21,074,834 (-)	NCBI		UU_Cfam_GSD_1.0

Sdhd
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	94,336,365 - 94,348,330 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936612	2,357,336 - 2,369,204 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SDHD
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	9	39,790,595 - 39,803,950 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	9	39,790,654 - 39,803,602 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	9	44,632,268 - 44,645,249 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SDHD
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	103,443,666 - 103,452,681 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666043	22,530,988 - 22,540,558 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sdhd
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624784	7,241,836 - 7,251,916 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624784	7,241,770 - 7,252,016 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sdhd
29 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	103
Count of miRNA genes:	81
Interacting mature miRNAs:	95
Transcripts:	ENSRNOT00000059169
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2301416	Bp315	Blood pressure QTL 315		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	7670578	52670578	Rat
1354595	Despr4	Despair related QTL 4	2.16	0.0036	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	8	7688955	52688955	Rat
1354627	Despr14	Despair related QTL 14		0.0056	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	8	7688955	52688955	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
2317030	Wbc5	White blood cell count QTL 5	3.21	0.005	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	8	8736635	53736635	Rat
2317051	Aia18	Adjuvant induced arthritis QTL 18	2.42		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	8	8736635	53736635	Rat
1598824	Memor4	Memory QTL 4	2.5		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	8	9712220	53356647	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
1558646	Swd5	Spike wave discharge measurement QTL 5	3.45	0.00036	brain electrophysiology trait (VT:0010557)	brain spike-and-wave discharge frequency (CMO:0001742)	8	14906751	59906751	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	16290444	61290444	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
631648	Stl5	Serum triglyceride level QTL 5	4	0.0003	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	27205715	54998217	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	28242912	53961020	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
1331744	Bp217	Blood pressure QTL 217	3.398		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	58482492	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	30848154	61290444	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	30848154	61290444	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	30848154	61290444	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	8	46531639	119088626	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat

Markers in Region

RH127747

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	29,973,870 - 29,974,056 (+)	MAPPER	mRatBN7.2
mRatBN7.2	8	50,955,427 - 50,955,614 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	55,038,828 - 55,039,014	NCBI	Rnor6.0
Rnor_6.0	7	36,429,551 - 36,429,736	NCBI	Rnor6.0
Rnor_5.0	8	53,636,150 - 53,636,336	UniSTS	Rnor5.0
Rnor_5.0	7	36,491,796 - 36,491,981	UniSTS	Rnor5.0
RGSC_v3.4	7	32,538,544 - 32,538,729	UniSTS	RGSC3.4
RGSC_v3.4	8	53,965,771 - 53,965,957	UniSTS	RGSC3.4
Celera	8	50,503,848 - 50,504,034	UniSTS
Celera	7	27,047,463 - 27,047,648	UniSTS
Cytogenetic Map	8	q23	UniSTS

RH127901

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	50,944,915 - 50,945,109 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	55,028,317 - 55,028,510	NCBI	Rnor6.0
Rnor_5.0	8	53,625,639 - 53,625,832	UniSTS	Rnor5.0
RGSC_v3.4	8	53,955,259 - 53,955,452	UniSTS	RGSC3.4
Celera	8	50,493,376 - 50,493,569	UniSTS
RH 3.4 Map	8	543.1	UniSTS
Cytogenetic Map	8	q23	UniSTS

AI535349

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	184,127,219 - 184,127,379 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	198,717,301 - 198,717,460	NCBI	Rnor6.0
Rnor_5.0	2	218,204,235 - 218,204,394	UniSTS	Rnor5.0
RGSC_v3.4	2	191,391,086 - 191,391,245	UniSTS	RGSC3.4
Celera	2	176,652,443 - 176,652,602	UniSTS
RH 3.4 Map	3	735.19	UniSTS
Cytogenetic Map	2	q34	UniSTS
Cytogenetic Map	8	q23	UniSTS

RH134598

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	50,955,700 - 50,955,881 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	55,039,101 - 55,039,281	NCBI	Rnor6.0
Rnor_5.0	8	53,636,423 - 53,636,603	UniSTS	Rnor5.0
RGSC_v3.4	8	53,966,044 - 53,966,224	UniSTS	RGSC3.4
Celera	8	50,504,121 - 50,504,301	UniSTS
Cytogenetic Map	8	q23	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_198788	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC141541	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC059160	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473975	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209438	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212791	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212873	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213509	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214315	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215255	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215505	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216314	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230166	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233159	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000059169 ⟹ ENSRNOP00000055942

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	50,944,719 - 50,954,238 (-)	Ensembl
Rnor_6.0 Ensembl	8	55,028,125 - 55,037,604 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000095581 ⟹ ENSRNOP00000081393

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	50,944,704 - 50,952,224 (-)	Ensembl

RefSeq Acc Id:

NM_198788 ⟹ NP_942083

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	59,841,090 - 59,850,641 (-)	NCBI
mRatBN7.2	8	50,944,702 - 50,954,254 (-)	NCBI
Rnor_6.0	8	55,028,125 - 55,037,604 (-)	NCBI
Rnor_5.0	8	53,625,447 - 53,634,926 (-)	NCBI
RGSC_v3.4	8	53,955,067 - 53,964,547 (-)	RGD
Celera	8	50,493,184 - 50,502,624 (-)	RGD

Sequence:

show sequence

AAAAGCGAAATGGCGGTTCTCTTAAAGCTGGGCGTTCTCTGCAGTGGCCAAGGAGCTCGAGCTC
TGTCACTCCGAAGCCGGGCGGTCAGACCTGCTTTTGTGTCCGCATTTCTCCAGGACCAGCCTAC
CCCAGGATGGCGTGGCACCCAGCACATCCACCTGTCACCAAGCCACCAGTCTGGTTCCAAGGCC
GCATCTCTCCACTGGACCAGTGAGAGGGTTGTCAGTGTTTTGCTCTTGGGCCTGATTCCAGCTG
GGTACTTGAATCCCTGCTCTGTGGTGGACTACTCTCTGGCTGCAGCCCTCACCCTGCACAGTCA
CTGGGGCATTGGACAAGTGGTTACTGACTACGTTCATGGGGACGCACTGCAGAAGGCTACCAAG
GCAGGCCTCTTGGCAGTCTCAGCTTTGACCTTTGCTGGGCTTTGCTACTTCAATTACCACGATG
TAGGCATCTGCAGAGCGGTTGCCATGCTGTGGAAGCTCTGACCTCTTGGTGTAGCACTTTGATT
GTATGCCTCCTTGCCTCTGCTTTATCAATGCTGTTCACCTCACAATGAGGAGGGATGAAGAATA
AATCCGTTGGTGGGCAGAATGTCTTGTAATTACATGGCTATTTTCAGAATTTATTTGTTGAGGA
ATTAGGTTCACTCATTCGTGAGTCTGAGTTCCATTGTCACTGAGTCTGGTCGCCAGCTCATGTG
ACTCATGGTGTAACTGAACATTTCATAAGCTCATGTTGCCTTTGATCACTGTTTCTTAAGGAGA
GTCAGCTAATTGCTGTCAGGATAAGAGTAGACTTCTCTCCTCAGACTGGGAGGGAGAACTGTTC
ATTCGTGAGTCAGAGTTTGCATGAAATTGAACAGTATTCTGTTTGGAACCTTCCACTCTTGTTC
AGGTGGCCCCAGCTGTTGGTGGCTCTGTTTCTAGGGGACTTTTAATCAGGAGATGCCCTCAATT
ACTGATGTTTTTAAGTCTTAGGAAGGAAATTGAGGAAAGTTAGATTTCGGGAAGTTCAATTTAG
GGAGCTCTCCTTTGTAGAAGGGTTCAAATATGACAGATCGCAAACAGACTTACTCTTCAAATGT
CTCTCACTTGTGCAGGAATGAGCTGTCCAAAAAAAGTAAGACTAAGTAATAAACTGTCTTCCCA
CCGTGGGAGTTGTCAATGAGAAAGTGTACTCTGGAAAAGCAAAATTTTTAAATAAAATATTATA
TAATCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_942083	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH59160	(Get FASTA)	NCBI Sequence Viewer
	EDL95463	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000055942
	ENSRNOP00000055942.2
	ENSRNOP00000081393.1
	ENSRNOP00055039615
	ENSRNOP00060021840
	ENSRNOP00065022419
GenBank Protein	Q6PCT8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_942083 ⟸ NM_198788
- UniProtKB:	Q6PCT8 (UniProtKB/Swiss-Prot), A6J4E0 (UniProtKB/TrEMBL), A0A8I5ZSF4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAVLLKLGVLCSGQGARALSLRSRAVRPAFVSAFLQDQPTPGWRGTQHIHLSPSHQSGSKAASL HWTSERVVSVLLLGLIPAGYLNPCSVVDYSLAAALTLHSHWGIGQVVTDYVHGDALQKATKAGL LAVSALTFAGLCYFNYHDVGICRAVAMLWKL hide sequence

RefSeq Acc Id:

ENSRNOP00000055942 ⟸ ENSRNOT00000059169

RefSeq Acc Id:

ENSRNOP00000081393 ⟸ ENSRNOT00000095581

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q6PCT8-F1-model_v2	AlphaFold	Q6PCT8	1-159	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13695947

Promoter ID:

EPDNEW_R6471

Type:

initiation region

Name:

Sdhd_1

Description:

succinate dehydrogenase complex subunit D

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	55,037,623 - 55,037,683	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:735231	AgrOrtholog
BioCyc Gene	G2FUF-30560	BioCyc
BioCyc Pathway	PWY-3781 [aerobic respiration I (cytochrome c)]	BioCyc
	PWY-7279 [aerobic respiration II (cytochrome c) (yeast)]	BioCyc
BioCyc Pathway Image	PWY-3781	BioCyc
	PWY-7279	BioCyc
Ensembl Genes	ENSRNOG00000022980	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055027798	UniProtKB/Swiss-Prot
	ENSRNOG00060015893	UniProtKB/Swiss-Prot
	ENSRNOG00065016999	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000059169	ENTREZGENE
	ENSRNOT00000059169.3	UniProtKB/Swiss-Prot
	ENSRNOT00000095581.1	UniProtKB/TrEMBL
	ENSRNOT00055048140	UniProtKB/Swiss-Prot
	ENSRNOT00060027228	UniProtKB/Swiss-Prot
	ENSRNOT00065028359	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1300.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6887444	IMAGE-MGC_LOAD
InterPro	CybS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SQR/QFR_C/D	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:363061	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72971	IMAGE-MGC_LOAD
NCBI Gene	363061	ENTREZGENE
PANTHER	PTHR13337	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SUCCINATE DEHYDROGENASE [UBIQUINONE] CYTOCHROME B SMALL SUBUNIT, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CybS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Sdhd	PhenoGen
RatGTEx	ENSRNOG00000022980	RatGTEx
	ENSRNOG00055027798	RatGTEx
	ENSRNOG00060015893	RatGTEx
	ENSRNOG00065016999	RatGTEx
Superfamily-SCOP	SSF81343	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZSF4	ENTREZGENE, UniProtKB/TrEMBL
	A6J4E0	ENTREZGENE, UniProtKB/TrEMBL
	DHSD_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-09	Sdhd	succinate dehydrogenase complex subunit D	Sdhd	succinate dehydrogenase complex, subunit D, integral membrane protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Sdhd	succinate dehydrogenase complex, subunit D, integral membrane protein			Symbol and Name status set to approved	1299863	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	mutation of the human homolog is detected in hereditary paraganglioma (PGL), which is characterized by development of benign, vascularized tumors in the head and neck	1302858

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

BioCyc Pathways