Advanced Search (OLGA)

Gene: Gabrg1 (gamma-aminobutyric acid type A receptor subunit gamma 1) Rattus norvegicus

Analyze

Symbol:

Gabrg1

Name:

gamma-aminobutyric acid type A receptor subunit gamma 1

RGD ID:

621732

Description:

Enables GABA receptor binding activity and GABA-A receptor activity. Predicted to be involved in GABAergic synaptic transmission; chloride transmembrane transport; and inhibitory synapse assembly. Predicted to act upstream of or within chemical synaptic transmission. Part of signaling receptor complex. Orthologous to human GABRG1 (gamma-aminobutyric acid type A receptor subunit gamma1); INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

GABA(A) receptor subunit gamma-1; GABAAR subunit gamma-1; gamma-aminobutyric acid (GABA) A receptor, gamma 1; gamma-aminobutyric acid A receptor, gamma 1; gamma-aminobutyric acid receptor subunit gamma-1; gamma-aminobutyric acid type A receptor gamma 1 subunit

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	37,750,292 - 37,821,651 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	37,750,292 - 37,989,945 (+)	Ensembl				GRCr8
mRatBN7.2	14	37,396,217 - 37,469,606 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	37,396,294 - 37,635,956 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	37,753,276 - 37,828,496 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	39,058,046 - 39,133,276 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	37,538,976 - 37,614,195 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	14	38,027,298 - 38,098,642 (+)	NCBI
Lyon_Normotensive	14	38,140,058 - 38,211,400 (+)	NCBI
Lyon_Hypertensive	14	38,137,413 - 38,208,759 (+)	NCBI
F344_StmMcwi	14	38,158,250 - 38,229,588 (+)	NCBI
Rnor_6.0	14	39,964,502 - 40,051,306 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	39,964,588 - 40,049,354 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	14	39,777,443 - 39,860,718 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	39,878,182 - 39,951,391 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	36,610,452 - 36,681,348 (+)	NCBI		Celera
RGSC_v3.1	14	39,880,572 - 39,953,782 (+)	NCBI
Cytogenetic Map	14	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cholangiocarcinoma (ISO)

lung squamous cell carcinoma (ISO)

nonpapillary renal cell carcinoma (ISO)

prostate cancer (ISO)

trigeminal neuralgia (ISS)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3-chloropropane-1,2-diol (EXP)

8-Br-cAMP (ISO)

aflatoxin B1 (ISO)

alendronic acid (EXP)

ammonium chloride (EXP)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bicuculline (EXP)

bisphenol A (EXP,ISO)

CGP 52608 (ISO)

clothianidin (ISO)

copper atom (ISO)

copper(0) (ISO)

Cuprizon (EXP)

dieldrin (EXP)

famotidine (EXP)

fenvalerate (EXP)

flavonoids (EXP)

gamma-aminobutyric acid (EXP,ISO)

lipopolysaccharide (ISO)

maneb (ISO)

N-nitrosodiethylamine (EXP)

paraquat (ISO)

pirinixic acid (ISO)

raloxifene (EXP)

resveratrol (ISO)

tetrachloromethane (EXP)

trichloroethene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chemical synaptic transmission (ISO)

chloride transmembrane transport (IBA)

chloride transport (IEA)

gamma-aminobutyric acid signaling pathway (IEA)

inhibitory synapse assembly (IBA)

monoatomic ion transmembrane transport (IEA)

monoatomic ion transport (IEA)

regulation of postsynaptic membrane potential (IEA)

synaptic transmission, GABAergic (IBA)

Cellular Component

dendrite membrane (IBA)

GABA-A receptor complex (IBA)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

postsynapse (IBA)

postsynaptic membrane (IEA)

signaling receptor complex (IDA)

Molecular Function

extracellular ligand-gated monoatomic ion channel activity (IEA)

GABA receptor binding (IPI)

GABA-A receptor activity (IDA,IEA)

monoatomic ion channel activity (IEA)

transmembrane signaling receptor activity (IEA)

transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
7.	Identification, coassembly, and activity of gamma-aminobutyric acid receptor subunits in renal proximal tubular cells.	Sarang SS, etal., J Pharmacol Exp Ther. 2008 Jan;324(1):376-82. Epub 2007 Oct 24.
8.	Structural and functional characterization of the gamma 1 subunit of GABAA/benzodiazepine receptors.	Ymer S, etal., EMBO J 1990 Oct;9(10):3261-7.

Additional References at PubMed

PMID:10900017	PMID:11891290	PMID:18292084	PMID:24425869	PMID:33288547

Genomics

Comparative Map Data

Gabrg1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	37,750,292 - 37,821,651 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	14	37,750,292 - 37,989,945 (+)	Ensembl				GRCr8
mRatBN7.2	14	37,396,217 - 37,469,606 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	37,396,294 - 37,635,956 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	14	37,753,276 - 37,828,496 (+)	NCBI	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	39,058,046 - 39,133,276 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	37,538,976 - 37,614,195 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0
Dahl_SR_JrHsd	14	38,027,298 - 38,098,642 (+)	NCBI
Lyon_Normotensive	14	38,140,058 - 38,211,400 (+)	NCBI
Lyon_Hypertensive	14	38,137,413 - 38,208,759 (+)	NCBI
F344_StmMcwi	14	38,158,250 - 38,229,588 (+)	NCBI
Rnor_6.0	14	39,964,502 - 40,051,306 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	39,964,588 - 40,049,354 (+)	Ensembl		Rnor_6.0 Ensembl	rn6	Rnor6.0
Rnor_5.0	14	39,777,443 - 39,860,718 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	14	39,878,182 - 39,951,391 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	14	36,610,452 - 36,681,348 (+)	NCBI		Celera
RGSC_v3.1	14	39,880,572 - 39,953,782 (+)	NCBI
Cytogenetic Map	14	p11	NCBI

GABRG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	46,035,769 - 46,124,054 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	46,035,769 - 46,124,089 (-)	Ensembl		GRCh38.p14 Ensembl	hg38	GRCh38
GRCh37	4	46,037,786 - 46,126,071 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	45,732,543 - 45,820,839 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	4	45,878,716 - 45,967,010	NCBI
Celera	4	46,488,013 - 46,574,168 (-)	NCBI		Celera
Cytogenetic Map	4	p12	NCBI
HuRef	4	45,360,145 - 45,446,265 (-)	NCBI		HuRef
CHM1_1	4	46,036,916 - 46,125,198 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	46,004,706 - 46,090,897 (-)	NCBI		T2T-CHM13v2.0

Gabrg1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	70,906,512 - 70,999,960 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	70,906,506 - 70,999,960 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	5	70,751,047 - 70,842,617 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	70,751,047 - 70,842,617 (-)	Ensembl		GRCm38.p6 Ensembl	mm10	GRCm38
MGSCv37	5	71,142,286 - 71,233,856 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	5	71,030,182 - 71,121,752 (-)	NCBI		MGSCv36	mm8
Celera	5	68,018,391 - 68,111,259 (-)	NCBI		Celera
Cytogenetic Map	5	C3.1	NCBI
cM Map	5	37.43	NCBI

Gabrg1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955443	2,276,555 - 2,347,983 (+)	Ensembl		ChiLan1.0 Ensembl
ChiLan1.0	NW_004955443	2,276,592 - 2,353,312 (+)	NCBI	ChiLan1.0	ChiLan1.0

GABRG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	81,746,482 - 81,833,268 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	82,010,545 - 82,097,452 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	76,034,539 - 76,121,797 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	86,762,932 - 86,850,033 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	86,762,417 - 86,850,033 (+)	Ensembl		PanPan1.1 Ensembl	panPan2	panpan1.1

GABRG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	13	42,194,929 - 42,276,379 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	13	42,200,202 - 42,276,711 (-)	Ensembl		CanFam3.1 Ensembl	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	13	42,147,102 - 42,226,119 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	13	42,802,382 - 42,881,664 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	13	42,802,403 - 42,881,644 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	13	42,478,701 - 42,559,787 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	13	42,542,428 - 42,621,417 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	13	42,891,593 - 42,972,762 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gabrg1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mIctTri1.hap1	9	35,088,878 - 35,172,320 (-)	NCBI		mIctTri1.hap1
HiC_Itri_2	NW_024405285	33,824,202 - 33,908,100 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936482	12,392,248 - 12,474,056 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936482	12,390,328 - 12,473,904 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GABRG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	36,198,060 - 36,262,430 (-)	Ensembl		Sscrofa11.1 Ensembl	susScr11	Sscrofa11.1
Sscrofa11.1	8	36,198,056 - 36,262,492 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	38,019,051 - 38,061,900 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GABRG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mChlSab1.0.hap1	27	4,352,722 - 4,453,694 (+)	NCBI		mChlSab1.0.hap1
Vero_WHO_p1.0	NW_023666047	50,208,763 - 50,323,326 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0
ChlSab1.1	27	4,133,320 - 4,224,366 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	27	4,133,161 - 4,219,122 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM

Gabrg1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624761	20,964,359 - 21,045,151 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2
HetGla_female_1.0 Ensembl	NW_004624761	20,964,276 - 21,040,418 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
Naked mole-rat maternal Ensembl	10	20,776,430 - 20,853,759 (+)	Ensembl

Gabrg1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	11	27,634,095 - 27,709,557 (-)	NCBI	Rrattus_CSIRO_v1	Rrattus_CSIRO_v1

Variants

Variants in Gabrg1
797 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	116
Count of miRNA genes:	93
Interacting mature miRNAs:	96
Transcripts:	ENSRNOT00000003240
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411573	Bw139	Body weight QTL 139	4.7	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	14	1	40068101	Rat
9589814	Gluco67	Glucose level QTL 67	4.54	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	1	40068101	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9393298	39411170	Rat
1300154	Bp189	Blood pressure QTL 189	3.04		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	14	31238080	72970315	Rat
70187	Pancm5	Pancreatic morphology QTL 5	16.7		pancreas mass (VT:0010144)	pancreas weight to body weight ratio (CMO:0000630)	14	30674469	85041098	Rat
2324617	Coatc2	Coat color QTL 2		0.001	coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	14	31121333	39507682	Rat
631523	Pia13	Pristane induced arthritis QTL 13	3.3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	33424686	102238540	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8621398	53621398	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18915454	42433608	Rat
7387267	Uae42	Urinary albumin excretion QTL 42		0.61	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	14	22521517	67521517	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11334716	100078267	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18895192	63895192	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17906726	54251504	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41415516	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8621398	53621398	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

adipose tissue	alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	entire extraembryonic component	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	pharyngeal arch	renal system	reproductive system	respiratory system	sensory system	visual system
229	32	146	273	3942	112	143	1	31	54	26	75	865	378	179	3892	6	282	456	121	136	136

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_080586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X57514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003240 ⟹ ENSRNOP00000003240

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	37,396,294 - 37,635,956 (+)	Ensembl
Rnor_6.0 Ensembl	14	39,964,588 - 40,049,354 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000108194 ⟹ ENSRNOP00000086867

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	37,396,294 - 37,635,956 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120635 ⟹ ENSRNOP00000098270

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	37,750,292 - 37,989,945 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000120636 ⟹ ENSRNOP00000098271

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	14	37,750,292 - 37,989,945 (+)	Ensembl

RefSeq Acc Id:

NM_080586 ⟹ NP_542153

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	37,750,292 - 37,821,651 (+)	NCBI
mRatBN7.2	14	37,396,294 - 37,467,654 (+)	NCBI
Dahl_SR_JrHsd	14	38,027,298 - 38,098,642 (+)	NCBI
Lyon_Normotensive	14	38,140,058 - 38,211,400 (+)	NCBI
Lyon_Hypertensive	14	38,137,413 - 38,208,759 (+)	NCBI
F344_StmMcwi	14	38,158,250 - 38,229,588 (+)	NCBI
Rnor_6.0	14	39,964,588 - 40,049,354 (+)	NCBI
Rnor_5.0	14	39,777,443 - 39,860,718 (+)	NCBI
RGSC_v3.4	14	39,878,182 - 39,951,391 (+)	RGD
Celera	14	36,610,452 - 36,681,348 (+)	RGD

Sequence:

show sequence

CTATGCACATTCCTTGTACTCACTGTGCTGCTGCTGAGGTGTGAGGCAAACTCCGCTTGGGGAC
TGAGCTAGTGGAGAAAGGATCTTAAAAGCGACCTGATGGGTTCTGGGAAAGTCTTCCTTTTCTC
TCCTTCCCTCCTGTGGAGTCAAACTAGAGGAGTGAGGTTGATATTCTTGTTACTAACCCTGCAT
CTGGGAAACTGCATTGATAAAGCAGATGATGAAGATGATGAAGATTTAACTATGAACAAAACAT
GGGTCTTGGCACCTAAAATTCATGAAGGAGATATCACACAGATTCTCAACTCTTTACTTCAAGG
CTATGATAACAAACTTCGTCCAGATATAGGCGTGAGACCCACAGTAATTGAAACTGATGTTTAT
GTAAACAGCATTGGACCTGTTGATCCCATAAACATGGAGTACACGATAGACATCATTTTTGCCC
AGACTTGGTTCGATAGCCGTTTAAAGTTCAACAGCACCATGAAAGTCCTTATGCTTAACAGCAA
CATGGTGGGAAAAATTTGGATCCCTGACACGTTCTTCAGGAACTCAAGGAAATCTGATGCGCAC
TGGATAACAACGCCCAATCGCCTGCTGCGGATATGGAGTGATGGAAGGGTTCTCTACACTCTGA
GATTAACAATTAATGCAGAATGCTACCTTCAACTCCATAACTTTCCTATGGATGAACATTCCTG
TCCACTGGAATTTTCAAGCTATGGATACCCTAAAAATGAAATTGAGTACAAGTGGAAAAAGCCC
TCAGTGGAAGTGGCTGATCCTAAGTACTGGAGATTGTATCAGTTTGCCTTTGTAGGGTTAAGAA
ATTCAACCGAAATCTCTCACACAATCTCCGGAGATTATATTATCATGACTATCTTTTTTGACCT
GAGCAGACGGATGGGCTATTTCACAATTCAGACCTACATTCCGTGCATTCTAACAGTTGTTCTT
TCCTGGGTGTCTTTTTGGATCAACAAAGATGCTGTACCTGCTAGAACATCCCTGGGTATCACTA
CGGTTTTGACTATGACAACCCTCAGTACAATCGCTAGAAAATCTTTACCTAAGGTTTCTTACGT
GACAGCAATGGATCTCTTTGTCTCTGTGTGTTTCATTTTTGTGTTTGCAGCACTCATGGAGTAT
GGAACCTTGCATTATTTTACTAGTAACAATAAAGGAAAAACCACCAGAGACAGGAAGCTGAAAA
GCAAAACTTCGGTATCCCCAGGTCTCCATGCTGGATCTACTCTGATTCCCATGAACAACATTTC
TATGCCTCAAGGGGAAGATGATTATGGTTACCAGTGCTTGGAGGGCAAAGACTGTGCTACCTTT
TTCTGTTGCTTTGAAGACTGCAGAACTGGGTCCTGGAGAGAAGGGCGAATACACATACGCATTG
CCAAAATCGACTCCTACTCCAGGATCTTTTTCCCAACAGCTTTTGCCTTGTTCAATCTGGTTTA
CTGGGTTGGATATCTATACTTATAAGTTCTGCCAATAGATAAAAAAATTCATAAAAATCTGGCT
TAGTCCAATATAATCACTTCGATTTCATAACAGGAAGTTAGAATTTAAAATGAAAGTCTACCAG
TTAAAATCTGAATCATTTGGTCATATGATTAAGGCTTTCATAAATAAATAAGAAAGAATTATTC
AGGTTAATTTACCTAACTAAACATGAAATTCATGTCCAATATAGCACATTTAAANCAGTAAACT
TAATAATTTTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_542153	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA40739	(Get FASTA)	NCBI Sequence Viewer
	EDL90009	(Get FASTA)	NCBI Sequence Viewer
	EDL90010	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000098270
	ENSRNOP00000098270.1
	ENSRNOP00055006369
	ENSRNOP00060022667
	ENSRNOP00065028248
GenBank Protein	P23574	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_542153 ⟸ NM_080586
- Peptide Label:	precursor
- UniProtKB:	P23574 (UniProtKB/Swiss-Prot), A0ABK0L3A3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGSGKVFLFSPSLLWSQTRGVRLIFLLLTLHLGNCIDKADDEDDEDLTMNKTWVLAPKIHEGDI TQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWFDSRLKFNS TMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWSDGRVLYTLRLTINAECYLQL HNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAFVGLRNSTEISHTISGD YIIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIA RKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSNNKGKTTRDRKLKSKTSVSPGLHAG STLIPMNNISMPQGEDDYGYQCLEGKDCATFFCCFEDCRTGSWREGRIHIRIAKIDSYSRIFFP TAFALFNLVYWVGYLYL hide sequence

Ensembl Acc Id:

ENSRNOP00000003240 ⟸ ENSRNOT00000003240

Ensembl Acc Id:

ENSRNOP00000086867 ⟸ ENSRNOT00000108194

Ensembl Acc Id:

ENSRNOP00000098270 ⟸ ENSRNOT00000120635

Ensembl Acc Id:

ENSRNOP00000098271 ⟸ ENSRNOT00000120636

Protein Domains

Neurotransmitter-gated ion-channel ligand-binding Neurotransmitter-gated ion-channel transmembrane

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P23574-F1-model_v2	AlphaFold	P23574	1-465	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621732	AgrOrtholog
BioCyc Gene	G2FUF-15831	BioCyc
Ensembl Genes	ENSRNOG00000002360	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055005249	UniProtKB/Swiss-Prot
	ENSRNOG00060016429	UniProtKB/Swiss-Prot
	ENSRNOG00065020724	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000120635	ENTREZGENE
	ENSRNOT00000120635.2	UniProtKB/Swiss-Prot
	ENSRNOT00055008418	UniProtKB/Swiss-Prot
	ENSRNOT00060028149	UniProtKB/Swiss-Prot
	ENSRNOT00065035131	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.58.390	UniProtKB/Swiss-Prot
	2.70.170.10	UniProtKB/Swiss-Prot
InterPro	GABAA/Glycine_rcpt	UniProtKB/Swiss-Prot
	GABBAg1_rcpt	UniProtKB/Swiss-Prot
	GABBAg_rcpt	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd	UniProtKB/Swiss-Prot
	Neur_chan_lig-bd_sf	UniProtKB/Swiss-Prot
	Neur_channel	UniProtKB/Swiss-Prot
	Neuro-gated_channel_TM_sf	UniProtKB/Swiss-Prot
	Neuro_actylchol_rec	UniProtKB/Swiss-Prot
	Neurotrans-gated_channel_TM	UniProtKB/Swiss-Prot
	Neurotransmitter_ion_chnl_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:140674	UniProtKB/Swiss-Prot
NCBI Gene	140674	ENTREZGENE
PANTHER	PTHR18945	UniProtKB/Swiss-Prot
Pfam	Neur_chan_LBD	UniProtKB/Swiss-Prot
	Neur_chan_memb	UniProtKB/Swiss-Prot
PhenoGen	Gabrg1	PhenoGen
PRINTS	GABAARECEPTR	UniProtKB/Swiss-Prot
	GABAARGAMMA	UniProtKB/Swiss-Prot
	GABAARGAMMA1	UniProtKB/Swiss-Prot
	NRIONCHANNEL	UniProtKB/Swiss-Prot
PROSITE	NEUROTR_ION_CHANNEL	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000002360	RatGTEx
	ENSRNOG00055005249	RatGTEx
	ENSRNOG00060016429	RatGTEx
	ENSRNOG00065020724	RatGTEx
Superfamily-SCOP	SSF63712	UniProtKB/Swiss-Prot
	SSF90112	UniProtKB/Swiss-Prot
UniProt	A0ABK0L3A3	ENTREZGENE, UniProtKB/TrEMBL
	GBRG1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-12-06	Gabrg1	gamma-aminobutyric acid type A receptor subunit gamma 1	Gabrg1	gamma-aminobutyric acid type A receptor gamma 1 subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-11	Gabrg1	gamma-aminobutyric acid type A receptor gamma 1 subunit	Gabrg1	gamma-aminobutyric acid (GABA) A receptor, gamma 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-25	Gabrg1	gamma-aminobutyric acid (GABA) A receptor, gamma 1	Gabrg1	gamma-aminobutyric acid A receptor, gamma 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-11-17	Gabrg1	gamma-aminobutyric acid A receptor, gamma 1		gamma-aminobutyric acid (GABA) A receptor, gamma 1	Name updated	1299863	APPROVED
2004-12-14	Gabrg1	gamma-aminobutyric acid (GABA) A receptor, gamma 1			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Gabrg1	gamma-aminobutyric acid (GABA) A receptor, gamma 1			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI