PRSS58 (serine protease 58) - Rat Genome Database

Name: PRSS58
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: PRSS58 (serine protease 58) Homo sapiens

Analyze

Symbol:

PRSS58

Name:

serine protease 58

RGD ID:

1606966

HGNC Page

HGNC:39125

Description:

Predicted to enable serine-type endopeptidase activity. Predicted to be involved in proteolysis. Predicted to be located in extracellular region. Predicted to be active in secretory granule.

Type:

protein-coding

RefSeq Status:

REVIEWED

Previously known as:

FLJ16649; MGC35022; protease, serine 58; protease, serine, 58; PRSS1; TRY1; trypsin X3; trypsin-X3; TRYX3; UNQ2540

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Prss58 (serine protease 58)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Prss58 (serine protease 58)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, Panther, PhylomeDB, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Prss58 (serine protease 58)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	PRSS58 (serine protease 58)	NCBI	Ortholog
Canis lupus familiaris (dog):	LOC475522 (serine protease 58-like)	HGNC	EggNOG, Ensembl, HomoloGene, OrthoDB, PhylomeDB, Treefam
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prss58 (serine protease 58)	NCBI	Ortholog
Sus scrofa (pig):	PRSS58 (serine protease 58)	HGNC	NCBI
Chlorocebus sabaeus (green monkey):	PRSS58 (serine protease 58)	NCBI	Ortholog
Heterocephalus glaber (naked mole-rat):	Prss58 (serine protease 58)	NCBI	Ortholog
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Prss58 (serine protease 58)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Prss58 (serine protease 58)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

PRSS59P

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	142,252,143 - 142,258,058 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	142,252,143 - 142,258,058 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	141,951,963 - 141,957,878 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	141,598,441 - 141,604,347 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	136,729,455 - 136,735,370 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI
HuRef	7	136,246,697 - 136,252,617 (-)	NCBI		HuRef
CHM1_1	7	141,886,110 - 141,892,030 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	143,567,197 - 143,573,112 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	141,290,166 - 141,296,085 (-)	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Hereditary Pancreatitis (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

aflatoxin B1 (EXP)

benzo[a]pyrene (EXP)

bisphenol A (ISO)

pirinixic acid (ISO)

resveratrol (EXP)

valproic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

proteolysis (IEA)

Cellular Component

extracellular region (IEA)

secretory granule (IBA)

Molecular Function

serine-type endopeptidase activity (IEA)

serine-type peptidase activity (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8650574	PMID:12477932	PMID:12690205	PMID:12975309	PMID:14702039	PMID:16751668	PMID:21873635	PMID:34638806

Genomics

Comparative Map Data

PRSS58
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	7	142,252,143 - 142,258,058 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	7	142,252,143 - 142,258,058 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	7	141,951,963 - 141,957,878 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	7	141,598,441 - 141,604,347 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	7	136,729,455 - 136,735,370 (-)	NCBI		Celera
Cytogenetic Map	7	q34	NCBI
HuRef	7	136,246,697 - 136,252,617 (-)	NCBI		HuRef
CHM1_1	7	141,886,110 - 141,892,030 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	7	143,567,197 - 143,573,112 (-)	NCBI		T2T-CHM13v2.0
CRA_TCAGchr7v2	7	141,290,166 - 141,296,085 (-)	NCBI

Prss58
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	40,872,196 - 40,877,321 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	40,872,204 - 40,877,321 (-)	Ensembl		GRCm39 Ensembl
GRCm38	6	40,895,262 - 40,900,387 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	40,895,270 - 40,900,387 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	40,845,261 - 40,850,386 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	40,824,869 - 40,829,994 (-)	NCBI		MGSCv36	mm8
Celera	6	40,881,514 - 40,886,641 (-)	NCBI		Celera
Cytogenetic Map	6	B1	NCBI
cM Map	6	18.94	NCBI

Prss58
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	70,719,326 - 70,731,158 (-)	NCBI		GRCr8
mRatBN7.2	4	69,752,646 - 69,757,306 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	69,752,573 - 69,756,962 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	74,676,103 - 74,680,032 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	70,597,244 - 70,601,173 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	69,010,706 - 69,014,647 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	69,145,435 - 69,152,111 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	69,145,397 - 69,149,520 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	133,935,374 - 133,939,671 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	68,534,119 - 68,538,075 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	68,810,248 - 68,814,205 (-)	NCBI
Celera	4	64,743,249 - 64,747,205 (-)	NCBI		Celera
Cytogenetic Map	4	q23	NCBI

Prss58
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955494	1,277,297 - 1,283,748 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955494	1,277,333 - 1,283,610 (+)	NCBI	ChiLan1.0	ChiLan1.0

PRSS58
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	6	179,035,095 - 179,042,947 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	7	31,045,350 - 31,053,202 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	7	134,179,697 - 134,185,609 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	7	146,649,838 - 146,655,755 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	7	146,649,838 - 146,655,728 (-)	Ensembl	panpan1.1		panPan2

LOC475522
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	16	7,001,061 - 7,005,198 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	16	7,001,408 - 7,005,186 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	16	7,859,857 - 7,863,994 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	16	6,922,105 - 6,926,242 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	16	6,922,452 - 6,926,230 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	16	6,875,606 - 6,879,743 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	16	6,716,965 - 6,721,091 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	16	6,785,611 - 6,789,748 (+)	NCBI		UU_Cfam_GSD_1.0

Prss58
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	13,166,133 - 13,170,467 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936971	193,268 - 195,843 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936971	193,268 - 195,843 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRSS58
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	18	7,715,879 - 7,723,937 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	18	7,715,969 - 7,725,465 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	18	7,984,174 - 7,992,282 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRSS58
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	21	110,988,537 - 110,994,720 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	21	110,988,631 - 110,994,088 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666072	7,694,375 - 7,702,860 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prss58
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624821	9,612,653 - 9,618,461 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in PRSS58
21 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 7q32.1-36.3(chr7:129310166-159282390)x3	copy number gain	See cases [RCV000050876]	Chr7:129310166..159282390 [GRCh38] Chr7:128950007..159075079 [GRCh37] Chr7:128737243..158767840 [NCBI36] Chr7:7q32.1-36.3	pathogenic
GRCh38/hg38 7q32.3-36.3(chr7:132850196-159325876)x3	copy number gain	See cases [RCV000051101]	Chr7:132850196..159325876 [GRCh38] Chr7:132534956..159118566 [GRCh37] Chr7:132185496..158811327 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh38/hg38 7p22.3-q36.3(chr7:53985-159282531)x1	copy number loss	See cases [RCV000052250]	Chr7:53985..159282531 [GRCh38] Chr7:53985..159075220 [GRCh37] Chr7:149068..158767981 [NCBI36] Chr7:7p22.3-q36.3	pathogenic
GRCh38/hg38 7q33-36.3(chr7:136309982-159307523)x3	copy number gain	See cases [RCV000053576]	Chr7:136309982..159307523 [GRCh38] Chr7:135994730..159100212 [GRCh37] Chr7:135645270..158792973 [NCBI36] Chr7:7q33-36.3	pathogenic
GRCh38/hg38 7q34-36.3(chr7:142021716-159325876)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053577]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053577]\|See cases [RCV000053577]	Chr7:142021716..159325876 [GRCh38] Chr7:142528609..159118566 [GRCh37] Chr7:141367985..158811327 [NCBI36] Chr7:7q34-36.3	pathogenic
GRCh38/hg38 7q32.3-36.1(chr7:132023155-149309794)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000054172]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000054172]\|See cases [RCV000054172]	Chr7:132023155..149309794 [GRCh38] Chr7:131707914..149006885 [GRCh37] Chr7:131358454..148637818 [NCBI36] Chr7:7q32.3-36.1	pathogenic
GRCh38/hg38 7q33-35(chr7:135414108-144140219)x1	copy number loss	See cases [RCV000054173]	Chr7:135414108..144140219 [GRCh38] Chr7:135098857..143837312 [GRCh37] Chr7:134749397..143468245 [NCBI36] Chr7:7q33-35	pathogenic
GRCh38/hg38 7q34-36.3(chr7:139365967-159282531)x1	copy number loss	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000054175]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000054175]\|See cases [RCV000054175]	Chr7:139365967..159282531 [GRCh38] Chr7:139050713..159075220 [GRCh37] Chr7:138701253..158767981 [NCBI36] Chr7:7q34-36.3	pathogenic
GRCh38/hg38 7q34-36.3(chr7:140754198-159307523)x1	copy number loss	See cases [RCV000054176]	Chr7:140754198..159307523 [GRCh38] Chr7:140453998..159100212 [GRCh37] Chr7:140100467..158792973 [NCBI36] Chr7:7q34-36.3	pathogenic
NM_001001317.4(PRSS58):c.185T>C (p.Leu62Pro)	single nucleotide variant	Malignant melanoma [RCV000061574]	Chr7:142255306 [GRCh38] Chr7:141955126 [GRCh37] Chr7:141601603 [NCBI36] Chr7:7q34	not provided
NM_001001317.4(PRSS58):c.-104T>A	single nucleotide variant	Lung cancer [RCV000105692]	Chr7:142258053 [GRCh38] Chr7:141957873 [GRCh37] Chr7:7q34	uncertain significance
GRCh38/hg38 7q34-35(chr7:141126407-145652221)x3	copy number gain	See cases [RCV000133645]	Chr7:141126407..145652221 [GRCh38] Chr7:140826207..145349314 [GRCh37] Chr7:140472676..144980247 [NCBI36] Chr7:7q34-35	pathogenic
GRCh38/hg38 7p22.3-q36.3(chr7:54185-159282390)x1	copy number loss	See cases [RCV000135401]	Chr7:54185..159282390 [GRCh38] Chr7:54185..159075079 [GRCh37] Chr7:149268..158767840 [NCBI36] Chr7:7p22.3-q36.3	pathogenic
GRCh38/hg38 7q33-36.2(chr7:137751200-154815582)x3	copy number gain	See cases [RCV000136592]	Chr7:137751200..154815582 [GRCh38] Chr7:137435946..154607292 [GRCh37] Chr7:137086486..154238225 [NCBI36] Chr7:7q33-36.2	pathogenic
GRCh38/hg38 7q21.3-36.3(chr7:97419852-158923762)x3	copy number gain	See cases [RCV000136717]	Chr7:97419852..158923762 [GRCh38] Chr7:97049164..158716453 [GRCh37] Chr7:96887100..158409214 [NCBI36] Chr7:7q21.3-36.3	pathogenic
GRCh38/hg38 7q34(chr7:142237788-142779344)x3	copy number gain	See cases [RCV000137716]	Chr7:142237788..142779344 [GRCh38] Chr7:141584064..142187156 [NCBI36] Chr7:7q34	likely benign
GRCh38/hg38 7q34-36.3(chr7:141960861-159335866)x1	copy number loss	See cases [RCV000137256]	Chr7:141960861..159335866 [GRCh38] Chr7:142528609..159128556 [GRCh37] Chr7:141307130..158821317 [NCBI36] Chr7:7q34-36.3	pathogenic
GRCh38/hg38 7q33-36.3(chr7:134666829-158591882)x1	copy number loss	See cases [RCV000138120]	Chr7:134666829..158591882 [GRCh38] Chr7:134351581..158384574 [GRCh37] Chr7:134002121..158077335 [NCBI36] Chr7:7q33-36.3	pathogenic
GRCh38/hg38 7q31.32-36.3(chr7:121863759-159335865)x3	copy number gain	See cases [RCV000138847]	Chr7:121863759..159335865 [GRCh38] Chr7:121503813..159128555 [GRCh37] Chr7:121291049..158821316 [NCBI36] Chr7:7q31.32-36.3	pathogenic
GRCh38/hg38 7q33-36.1(chr7:135017687-148807400)x1	copy number loss	See cases [RCV000138903]	Chr7:135017687..148807400 [GRCh38] Chr7:134702438..148504492 [GRCh37] Chr7:134352978..148135425 [NCBI36] Chr7:7q33-36.1	pathogenic
GRCh38/hg38 7q32.3-36.3(chr7:132444095-159335866)x3	copy number gain	See cases [RCV000139654]	Chr7:132444095..159335866 [GRCh38] Chr7:132128854..159128556 [GRCh37] Chr7:131779394..158821317 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh38/hg38 7q31.2-36.3(chr7:115459015-159325817)x3	copy number gain	See cases [RCV000141413]	Chr7:115459015..159325817 [GRCh38] Chr7:115099069..159118507 [GRCh37] Chr7:114886305..158811268 [NCBI36] Chr7:7q31.2-36.3	pathogenic
GRCh38/hg38 7q32.3-36.3(chr7:131228764-159335866)x3	copy number gain	See cases [RCV000142802]	Chr7:131228764..159335866 [GRCh38] Chr7:130913523..159128556 [GRCh37] Chr7:130564063..158821317 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh38/hg38 7q32.3-36.3(chr7:131171478-159327017)x3	copy number gain	See cases [RCV000143754]	Chr7:131171478..159327017 [GRCh38] Chr7:130856237..159119707 [GRCh37] Chr7:130506777..158812468 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh38/hg38 7q34-35(chr7:140061285-144622893)x3	copy number gain	See cases [RCV000143724]	Chr7:140061285..144622893 [GRCh38] Chr7:139761085..144319986 [GRCh37] Chr7:139407554..143950919 [NCBI36] Chr7:7q34-35	uncertain significance
GRCh37/hg19 7q34(chr7:141937588-142486548)x3	copy number gain	See cases [RCV000143759]	Chr7:141937588..142486548 [GRCh37] Chr7:141584062..142186550 [NCBI36] Chr7:7q34	uncertain significance
GRCh38/hg38 7q32.3-36.3(chr7:132438072-159327017)x3	copy number gain	See cases [RCV000143707]	Chr7:132438072..159327017 [GRCh38] Chr7:132122831..159119707 [GRCh37] Chr7:131773371..158812468 [NCBI36] Chr7:7q32.3-36.3	pathogenic
GRCh37/hg19 7q34(chr7:141937588-142716850)x3	copy number gain	Newborn respiratory distress syndrome [RCV002284310]	Chr7:141937588..142716850 [GRCh37] Chr7:7q34	uncertain significance
GRCh37/hg19 7q32.1-36.3(chr7:128312450-159119220)	copy number gain	not provided [RCV000767558]	Chr7:128312450..159119220 [GRCh37] Chr7:7q32.1-36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:137589621-159119707)x3	copy number gain	See cases [RCV000449264]	Chr7:137589621..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:43360-159119707)x1	copy number loss	See cases [RCV000446044]	Chr7:43360..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:133799185-159119707)x1	copy number loss	See cases [RCV000448836]	Chr7:133799185..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7q22.1-36.3(chr7:98969247-159119707)x3	copy number gain	See cases [RCV000447709]	Chr7:98969247..159119707 [GRCh37] Chr7:7q22.1-36.3	pathogenic
GRCh37/hg19 7q32.1-36.3(chr7:128276078-159119707)x3	copy number gain	See cases [RCV000447956]	Chr7:128276078..159119707 [GRCh37] Chr7:7q32.1-36.3	pathogenic
GRCh37/hg19 7q34-36.3(chr7:140636858-159119707)x1	copy number loss	See cases [RCV000510250]	Chr7:140636858..159119707 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:43361-159119707)	copy number gain	See cases [RCV000510686]	Chr7:43361..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:136758593-159119707)x3	copy number gain	See cases [RCV000510490]	Chr7:136758593..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:43361-159119707)x3	copy number gain	See cases [RCV000511549]	Chr7:43361..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:137917376-159119707)x1	copy number loss	See cases [RCV000511889]	Chr7:137917376..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
NM_001001317.5(PRSS58):c.16C>G (p.Leu6Val)	single nucleotide variant	not specified [RCV004281908]	Chr7:142257692 [GRCh38] Chr7:141957512 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.326C>G (p.Thr109Arg)	single nucleotide variant	not specified [RCV004320868]	Chr7:142255165 [GRCh38] Chr7:141954985 [GRCh37] Chr7:7q34	likely benign
GRCh37/hg19 7q34(chr7:141854658-141963253)x1	copy number loss	not provided [RCV000682784]	Chr7:141854658..141963253 [GRCh37] Chr7:7q34	likely benign\|uncertain significance
GRCh37/hg19 7q34-36.3(chr7:140133025-158982771)x1	copy number loss	not provided [RCV000682910]	Chr7:140133025..158982771 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7q22.1-36.3(chr7:98693388-159119707)x3	copy number gain	not provided [RCV000682911]	Chr7:98693388..159119707 [GRCh37] Chr7:7q22.1-36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:44935-159126310)x3	copy number gain	not provided [RCV000746280]	Chr7:44935..159126310 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:10704-159122532)x3	copy number gain	not provided [RCV000746278]	Chr7:10704..159122532 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q34-35(chr7:139623170-143710268)x3	copy number gain	not provided [RCV000747069]	Chr7:139623170..143710268 [GRCh37] Chr7:7q34-35	benign
GRCh37/hg19 7q34-36.3(chr7:139623170-158329903)x3	copy number gain	not provided [RCV000747070]	Chr7:139623170..158329903 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7q34-36.3(chr7:141938235-159126310)x1	copy number loss	not provided [RCV000747083]	Chr7:141938235..159126310 [GRCh37] Chr7:7q34-36.3	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:10365-159119707)x3	copy number gain	not provided [RCV000848126]	Chr7:10365..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q34(chr7:141932561-142486548)x3	copy number gain	not provided [RCV000849721]	Chr7:141932561..142486548 [GRCh37] Chr7:7q34	uncertain significance
GRCh37/hg19 7q34(chr7:141932561-142487154)x3	copy number gain	not provided [RCV000848854]	Chr7:141932561..142487154 [GRCh37] Chr7:7q34	uncertain significance
GRCh37/hg19 7q34-35(chr7:141751875-147105208)x3	copy number gain	not provided [RCV000848670]	Chr7:141751875..147105208 [GRCh37] Chr7:7q34-35	uncertain significance
GRCh37/hg19 7q32.3-36.3(chr7:131414604-159126310)x1	copy number loss	See cases [RCV001007432]	Chr7:131414604..159126310 [GRCh37] Chr7:7q32.3-36.3	pathogenic
GRCh37/hg19 7q32.3-36.3(chr7:130592554-159119707)x3	copy number gain	not provided [RCV000849569]	Chr7:130592554..159119707 [GRCh37] Chr7:7q32.3-36.3	pathogenic
GRCh37/hg19 7q31.1-36.3(chr7:109251060-159119707)x3	copy number gain	not provided [RCV001005994]	Chr7:109251060..159119707 [GRCh37] Chr7:7q31.1-36.3	pathogenic
GRCh38/hg38 7q33-36.3(chr7:137463392-159345973)x3	copy number gain	Neurodevelopmental disorder [RCV003327609]	Chr7:137463392..159345973 [GRCh38] Chr7:7q33-36.3	pathogenic
GRCh38/hg38 7q34-36.3(chr7:138620939-159233475)x3	copy number gain	Neurodevelopmental disorder [RCV003327610]	Chr7:138620939..159233475 [GRCh38] Chr7:7q34-36.3	likely pathogenic
NC_000007.13:g.141443350_142460881dup	duplication	Hereditary pancreatitis [RCV001250209]	Chr7:141443350..142460881 [GRCh37] Chr7:7q34	pathogenic
GRCh37/hg19 7q33-35(chr7:133848099-145814115)x1	copy number loss	Hypertelorism [RCV001801200]	Chr7:133848099..145814115 [GRCh37] Chr7:7q33-35	pathogenic
Single allele	complex	Ring chromosome 7 [RCV002280646]	Chr7:43360..159119707 [GRCh37] Chr7:7p22.3-q36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:133851002-159119707)x3	copy number gain	not provided [RCV001834520]	Chr7:133851002..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
NC_000007.13:g.(?_130781014)_(150301047_?)del	deletion	not provided [RCV003116360]	Chr7:130781014..150301047 [GRCh37] Chr7:7q32.3-36.1	pathogenic
GRCh37/hg19 7p22.3-q36.3(chr7:56604613-96692931)x1	copy number loss	See cases [RCV002287832]	Chr7:56604613..96692931 [GRCh37] Chr7:7p22.3-q36.3	uncertain significance
GRCh37/hg19 7q32.3-36.1(chr7:131779213-149042734)x1	copy number loss	not provided [RCV002472560]	Chr7:131779213..149042734 [GRCh37] Chr7:7q32.3-36.1	pathogenic
NM_001001317.5(PRSS58):c.379A>C (p.Ile127Leu)	single nucleotide variant	not specified [RCV004198548]	Chr7:142255112 [GRCh38] Chr7:141954932 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.501T>G (p.Asp167Glu)	single nucleotide variant	not specified [RCV004183918]	Chr7:142252547 [GRCh38] Chr7:141952367 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.190G>A (p.Val64Met)	single nucleotide variant	not specified [RCV004081046]	Chr7:142255301 [GRCh38] Chr7:141955121 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.79A>C (p.Thr27Pro)	single nucleotide variant	not specified [RCV004136327]	Chr7:142255635 [GRCh38] Chr7:141955455 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.496C>T (p.Arg166Cys)	single nucleotide variant	not specified [RCV004095113]	Chr7:142252552 [GRCh38] Chr7:141952372 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.143C>T (p.Pro48Leu)	single nucleotide variant	not specified [RCV004102358]	Chr7:142255571 [GRCh38] Chr7:141955391 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.499G>C (p.Asp167His)	single nucleotide variant	not specified [RCV004197560]	Chr7:142252549 [GRCh38] Chr7:141952369 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.302A>T (p.Asp101Val)	single nucleotide variant	not specified [RCV004240490]	Chr7:142255189 [GRCh38] Chr7:141955009 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.482C>A (p.Ser161Tyr)	single nucleotide variant	not specified [RCV004074791]	Chr7:142252566 [GRCh38] Chr7:141952386 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.448G>A (p.Asp150Asn)	single nucleotide variant	not specified [RCV004198398]	Chr7:142252600 [GRCh38] Chr7:141952420 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.640G>A (p.Gly214Arg)	single nucleotide variant	not specified [RCV004167374]	Chr7:142252307 [GRCh38] Chr7:141952127 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.86C>T (p.Pro29Leu)	single nucleotide variant	not specified [RCV004163072]	Chr7:142255628 [GRCh38] Chr7:141955448 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.694C>A (p.Pro232Thr)	single nucleotide variant	not specified [RCV004081088]	Chr7:142252253 [GRCh38] Chr7:141952073 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.565C>A (p.Gln189Lys)	single nucleotide variant	not specified [RCV004257310]	Chr7:142252483 [GRCh38] Chr7:141952303 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.410C>T (p.Thr137Ile)	single nucleotide variant	not specified [RCV004269998]	Chr7:142255081 [GRCh38] Chr7:141954901 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.271C>T (p.Pro91Ser)	single nucleotide variant	not specified [RCV004301958]	Chr7:142255220 [GRCh38] Chr7:141955040 [GRCh37] Chr7:7q34	uncertain significance
GRCh37/hg19 7q34-36.1(chr7:140154317-152551638)x1	copy number loss	not provided [RCV003334300]	Chr7:140154317..152551638 [GRCh37] Chr7:7q34-36.1	pathogenic
NM_001001317.5(PRSS58):c.56A>C (p.Asn19Thr)	single nucleotide variant	not specified [RCV004335066]	Chr7:142255658 [GRCh38] Chr7:141955478 [GRCh37] Chr7:7q34	uncertain significance
GRCh37/hg19 7q33-36.3(chr7:135639005-159119707)x1	copy number loss	not provided [RCV003482988]	Chr7:135639005..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
GRCh37/hg19 7q33-36.3(chr7:137456457-159119707)x3	copy number gain	not specified [RCV003986713]	Chr7:137456457..159119707 [GRCh37] Chr7:7q33-36.3	pathogenic
NM_001001317.5(PRSS58):c.590C>G (p.Ala197Gly)	single nucleotide variant	not specified [RCV004510781]	Chr7:142252357 [GRCh38] Chr7:141952177 [GRCh37] Chr7:7q34	uncertain significance
NM_001001317.5(PRSS58):c.718A>C (p.Asn240His)	single nucleotide variant	not specified [RCV004510783]	Chr7:142252229 [GRCh38] Chr7:141952049 [GRCh37] Chr7:7q34	uncertain significance
GRCh37/hg19 7q34-36.3(chr7:141690279-159119707)x3	copy number gain	See cases [RCV004442845]	Chr7:141690279..159119707 [GRCh37] Chr7:7q34-36.3	pathogenic
NM_001001317.5(PRSS58):c.188G>A (p.Arg63Gln)	single nucleotide variant	not specified [RCV004510779]	Chr7:142255303 [GRCh38] Chr7:141955123 [GRCh37] Chr7:7q34	likely benign
NM_001001317.5(PRSS58):c.646G>A (p.Val216Ile)	single nucleotide variant	not specified [RCV004510782]	Chr7:142252301 [GRCh38] Chr7:141952121 [GRCh37] Chr7:7q34	uncertain significance

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	338
Count of miRNA genes:	174
Interacting mature miRNAs:	176
Transcripts:	ENST00000547058, ENST00000552471
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Markers in Region

RH92570

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	7	141,952,098 - 141,952,340	UniSTS	GRCh37
Build 36	7	141,598,576 - 141,598,818	RGD	NCBI36
Celera	7	136,729,590 - 136,729,832	RGD
Cytogenetic Map	7	q34	UniSTS
HuRef	7	136,246,837 - 136,247,079	UniSTS
CRA_TCAGchr7v2	7	141,290,306 - 141,290,548	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

sensory system

adipose tissue

appendage

High

Medium

327

Low

Below cutoff

347

510

162

573

501

144

599

172

134

211

290

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NG_001333	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001001317	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AA625766	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC231381	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC245088	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK122940	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY358487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC035384	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH236959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471198	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068271	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ384426	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ384427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ384428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ384429	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ384431	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENST00000547058 ⟹ ENSP00000447588

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	7	142,252,143 - 142,258,058 (-)	Ensembl

RefSeq Acc Id:

ENST00000552471 ⟹ ENSP00000446916

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	7	142,252,144 - 142,258,027 (-)	Ensembl

RefSeq Acc Id:

NM_001001317 ⟹ NP_001001317

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	7	142,252,143 - 142,258,058 (-)	NCBI
GRCh37	7	141,951,958 - 141,957,878 (-)	ENTREZGENE
Build 36	7	141,598,441 - 141,604,347 (-)	NCBI Archive
Celera	7	136,729,455 - 136,735,370 (-)	RGD
HuRef	7	136,246,697 - 136,252,617 (-)	ENTREZGENE
CHM1_1	7	141,886,110 - 141,892,030 (-)	NCBI
T2T-CHM13v2.0	7	143,567,197 - 143,573,112 (-)	NCBI
CRA_TCAGchr7v2	7	141,290,166 - 141,296,085 (-)	ENTREZGENE

Sequence:

show sequence

AAGGCTGGCAAAAAGGAGACCAGACAGGAGGCGTCTGTAGAGATATCATGAACTTCAACTTAGC
TTTGTTTTCCAGAGACTGGAGCTAAACTGGGCTTTCAACATCATCATGAAGTTTATCCTCCTCT
GGGCTCTCTTGAATCTGACTGTTGCTTTGGCCTTTAATCCAGATTACACAGTCAGCTCCACTCC
CCCTTACTTGGTCTATTTGAAATCTGACTACTTGCCCTGCGCTGGAGTCCTGATCCACCCGCTT
TGGGTGATCACAGCTGCACACTGCAATTTACCAAAGCTTCGGGTGATATTGGGGGTTACAATCC
CAGCAGACTCTAATGAAAAGCATCTGCAAGTGATTGGCTATGAGAAGATGATTCATCATCCACA
CTTCTCAGTCACTTCTATTGATCATGACATCATGCTAATCAAGCTGAAAACAGAGGCTGAACTC
AATGACTATGTGAAATTAGCCAACCTGCCCTACCAAACTATCTCTGAAAATACCATGTGCTCTG
TCTCTACCTGGAGCTACAATGTGTGTGATATCTACAAAGAGCCCGATTCACTGCAAACTGTGAA
CATCTCTGTAATCTCCAAGCCTCAGTGTCGCGATGCCTATAAAACCTACAACATCACGGAAAAT
ATGCTGTGTGTGGGCATTGTGCCAGGAAGGAGGCAGCCCTGCAAGGAAGTTTCTGCTGCCCCGG
CAATCTGCAATGGGATGCTTCAAGGAATCCTGTCTTTTGCGGATGGATGTGTTTTGAGAGCTGA
TGTTGGCATCTATGCCAAAATTTTTTACTATATACCCTGGATTGAAAATGTAATCCAAAATAAC
TGAGCTGTGGCAGTTGTGGACCATATGACACAGCTTGTCCCCATCGTTCACCTTTAGAATTAAA
TATAAATTAACTCCTCA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001001317	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH35384	(Get FASTA)	NCBI Sequence Viewer
	AAQ88851	(Get FASTA)	NCBI Sequence Viewer
	ABD48876	(Get FASTA)	NCBI Sequence Viewer
	ABD48877	(Get FASTA)	NCBI Sequence Viewer
	ABD48878	(Get FASTA)	NCBI Sequence Viewer
	ABD48879	(Get FASTA)	NCBI Sequence Viewer
	ABD48880	(Get FASTA)	NCBI Sequence Viewer
	BAG53808	(Get FASTA)	NCBI Sequence Viewer
	EAL23772	(Get FASTA)	NCBI Sequence Viewer
	EAW51980	(Get FASTA)	NCBI Sequence Viewer
	EAW51981	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000446916.1
	ENSP00000447588
	ENSP00000447588.2
	ENSP00000478535.1
	ENSP00000479165.1
GenBank Protein	Q8IYP2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001001317 ⟸ NM_001001317
- Peptide Label:	precursor
- UniProtKB:	B3KVJ6 (UniProtKB/Swiss-Prot), D3DXD2 (UniProtKB/Swiss-Prot), Q8IYP2 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MKFILLWALLNLTVALAFNPDYTVSSTPPYLVYLKSDYLPCAGVLIHPLWVITAAHCNLPKLRV ILGVTIPADSNEKHLQVIGYEKMIHHPHFSVTSIDHDIMLIKLKTEAELNDYVKLANLPYQTIS ENTMCSVSTWSYNVCDIYKEPDSLQTVNISVISKPQCRDAYKTYNITENMLCVGIVPGRRQPCK EVSAAPAICNGMLQGILSFADGCVLRADVGIYAKIFYYIPWIENVIQNN hide sequence

RefSeq Acc Id:

ENSP00000447588 ⟸ ENST00000547058

RefSeq Acc Id:

ENSP00000446916 ⟸ ENST00000552471

Protein Domains

Peptidase S1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q8IYP2-F1-model_v2	AlphaFold	Q8IYP2	1-241	view protein structure

Promoters

RGD ID:

7212131

Promoter ID:

EPDNEW_H11812

Type:

initiation region

Name:

PRSS58_1

Description:

protease, serine 58

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	7	142,258,058 - 142,258,118	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:39125	AgrOrtholog
COSMIC	PRSS58	COSMIC
Ensembl Genes	ENSG00000258223	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSG00000276785	UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000547058	ENTREZGENE
	ENST00000547058.6	UniProtKB/Swiss-Prot
	ENST00000552471.1	UniProtKB/Swiss-Prot
	ENST00000621886.4	UniProtKB/Swiss-Prot
	ENST00000622880.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.10.10	UniProtKB/Swiss-Prot
GTEx	ENSG00000258223	GTEx
	ENSG00000276785	GTEx
HGNC ID	HGNC:39125	ENTREZGENE
Human Proteome Map	PRSS58	Human Proteome Map
InterPro	Peptidase_S1_PA	UniProtKB/Swiss-Prot
	Peptidase_S1_PA_chymotrypsin	UniProtKB/Swiss-Prot
	Peptidase_S1A	UniProtKB/Swiss-Prot
	Trypsin_dom	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
KEGG Report	hsa:136541	UniProtKB/Swiss-Prot
NCBI Gene	136541	ENTREZGENE
PANTHER	KALLIKREIN-RELATED	UniProtKB/Swiss-Prot
	SERINE PROTEASE 58	UniProtKB/Swiss-Prot
Pfam	Trypsin	UniProtKB/Swiss-Prot
PharmGKB	PA166049038	PharmGKB
PRINTS	CHYMOTRYPSIN	UniProtKB/Swiss-Prot
PROSITE	TRYPSIN_DOM	UniProtKB/Swiss-Prot
	TRYPSIN_HIS	UniProtKB/Swiss-Prot
SMART	Tryp_SPc	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50494	UniProtKB/Swiss-Prot
UniProt	B3KVJ6	ENTREZGENE
	D3DXD2	ENTREZGENE
	PRS58_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	B3KVJ6	UniProtKB/Swiss-Prot
	D3DXD2	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-01-23	PRSS58	serine protease 58	PRSS58	protease, serine 58	Symbol and/or name change	5135510	APPROVED
2015-11-24	PRSS58	protease, serine 58	PRSS58	protease, serine, 58	Symbol and/or name change	5135510	APPROVED
2011-07-27	PRSS58	protease, serine, 58	TRYX3	trypsin X3	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar