Ncbp2 (nuclear cap binding protein subunit 2)

Gene: Ncbp2 (nuclear cap binding protein subunit 2) Rattus norvegicus

Analyze

Symbol:

Ncbp2

Name:

nuclear cap binding protein subunit 2

RGD ID:

1596188

Description:

Enables RNA 7-methylguanosine cap binding activity. Predicted to be involved in several processes, including RNA export from nucleus; mRNA metabolic process; and positive regulation of mRNA 3'-end processing. Part of nuclear cap binding activity complex. Orthologous to several human genes including NCBP2 (nuclear cap binding protein subunit 2); PARTICIPATES IN 5'-end pre-mRNA capping pathway; RNA polymerase II transcription elongation pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; atrazine; fipronil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

20 kDa nuclear cap-binding protein; CBP20; LOC100911481; LOC108348149; LOC689116; NCBP 20 kDa subunit; nuclear cap-binding protein subunit 2; nuclear cap-binding protein subunit 2-like; phosphatidylinositol glycan anchor biosynthesis, class Z; Pigz; similar to nuclear cap binding protein subunit 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NCBP2 (nuclear cap binding protein subunit 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ncbp2 (nuclear cap binding protein subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NCBP2 (nuclear cap binding protein subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NCBP2 (nuclear cap binding protein subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NCBP2 (nuclear cap binding protein subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ncbp2 (nuclear cap binding protein subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	NCBP2L (nuclear cap binding protein subunit 2 like)	HGNC	EggNOG, OrthoDB, Panther
Alliance orthologs ³
Homo sapiens (human):	NCBP2 (nuclear cap binding protein subunit 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Ncbp2 (nuclear cap binding protein subunit 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NCBP2L (nuclear cap binding protein subunit 2 like)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	ncbp2 (nuclear cap binding protein subunit 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	CBC2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Cbp20	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ncbp-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ncbp2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	82,326,002 - 82,334,839 (-)	NCBI		GRCr8
mRatBN7.2	11	68,821,026 - 68,829,863 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	68,817,740 - 68,851,885 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	77,658,084 - 77,666,921 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	70,320,447 - 70,329,526 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	69,347,167 - 69,356,004 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	72,071,838 - 72,103,087 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	72,921,282 - 72,929,003 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	11	72,071,839 - 72,080,928 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	75,147,098 - 75,178,295 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	70,642,907 - 70,651,744 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	68,243,480 - 68,252,317 (-)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

chromosome 3q29 microdeletion syndrome (ISO)

genetic disease (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

atrazine (EXP)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (ISO)

Bisphenol B (ISO)

bleomycin A5 (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chrysene (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

cyclosporin A (ISO)

dicrotophos (ISO)

diethylstilbestrol (ISO)

dorsomorphin (ISO)

epoxiconazole (ISO)

fipronil (EXP)

gentamycin (EXP)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

nickel atom (ISO)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

pirinixic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sodium arsenite (ISO)

tamibarotene (ISO)

tetraphene (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

histone mRNA metabolic process (IEA,ISO)

mRNA cis splicing, via spliceosome (IEA,ISO,ISS)

mRNA export from nucleus (IEA,ISO)

mRNA metabolic process (ISO)

mRNA splicing, via spliceosome (IBA)

mRNA transcription by RNA polymerase II (IEA,ISO)

nuclear-transcribed mRNA catabolic process, nonsense-mediated decay (IEA,ISO)

positive regulation of mRNA 3'-end processing (IEA,ISO)

positive regulation of RNA export from nucleus (ISS)

regulation of translational initiation (IEA,ISO)

regulatory ncRNA-mediated gene silencing (IEA)

RNA splicing (ISS)

snRNA export from nucleus (ISS)

Cellular Component

cytoplasm (IEA,ISO)

membrane (IEA)

nuclear cap binding complex (IBA,IDA,IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IEA,ISO)

RNA cap binding complex (ISO)

Molecular Function

DNA binding (ISO)

glycosyltransferase activity (IEA)

mRNA binding (IEA,ISO,ISS)

protein binding (ISO)

RNA 7-methylguanosine cap binding (IDA,IEA,ISO,ISS)

RNA binding (ISO)

RNA cap binding (IBA,IEA)

snRNA binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

5'-end pre-mRNA capping pathway (ISO)

RNA polymerase II transcription elongation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Cap-binding complex (CBC).	Gonatopoulos-Pournatzis T and Cowling VH, Biochem J. 2014 Jan 15;457(2):231-42. doi: 10.1042/BJ20131214.
3.	GOA pipeline	RGD automated data pipeline
4.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Comprehensive gene review and curation	RGD comprehensive gene curation
7.	The nuclear cap-binding complex is a novel target of growth factor receptor-coupled signal transduction.	Wilson KF, etal., J Biol Chem. 1999 Feb 12;274(7):4166-73.

Additional References at PubMed

PMID:7478990	PMID:7651522	PMID:8601613	PMID:9342333	PMID:11551508	PMID:12434151	PMID:12477932	PMID:15489334	PMID:17873884	PMID:18369367	PMID:18426921	PMID:22658674
PMID:22673903	PMID:22681889	PMID:23793891	PMID:26382858

Genomics

Comparative Map Data

Ncbp2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	11	82,326,002 - 82,334,839 (-)	NCBI		GRCr8
mRatBN7.2	11	68,821,026 - 68,829,863 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	68,817,740 - 68,851,885 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	77,658,084 - 77,666,921 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	70,320,447 - 70,329,526 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	69,347,167 - 69,356,004 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	72,071,838 - 72,103,087 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	72,921,282 - 72,929,003 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	11	72,071,839 - 72,080,928 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	75,147,098 - 75,178,295 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	70,642,907 - 70,651,744 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	11	68,243,480 - 68,252,317 (-)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

NCBP2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	196,935,406 - 196,942,528 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	196,935,402 - 196,942,594 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	196,662,277 - 196,669,399 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	198,146,670 - 198,153,861 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	198,150,588 - 198,157,710	NCBI
Celera	3	195,248,888 - 195,256,079 (-)	NCBI		Celera
Cytogenetic Map	3	q29	NCBI
HuRef	3	193,962,416 - 193,969,608 (-)	NCBI		HuRef
CHM1_1	3	196,633,623 - 196,640,813 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	3	199,661,457 - 199,668,578 (-)	NCBI		T2T-CHM13v2.0

Ncbp2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	31,767,364 - 31,777,290 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	31,767,331 - 31,780,599 (+)	Ensembl		GRCm39 Ensembl
GRCm38	16	31,948,546 - 31,958,472 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	31,948,513 - 31,961,781 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	31,948,632 - 31,958,558 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	31,868,386 - 31,877,928 (+)	NCBI		MGSCv36	mm8
Celera	16	32,442,367 - 32,452,316 (+)	NCBI		Celera
Cytogenetic Map	16	B2	NCBI
cM Map	16	22.4	NCBI

NCBP2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	29,911,457 - 29,943,596 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	29,912,569 - 29,962,175 (-)	NCBI	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	29,935,367 - 29,967,481 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	30,183,638 - 30,191,656 (-)	NCBI		ROS_Cfam_1.0

NCBP2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	133,178,166 - 133,192,923 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	133,177,209 - 133,192,935 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	142,870,297 - 142,880,228 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NCBP2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	90,306,640 - 90,314,293 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	90,306,640 - 90,313,019 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	64,083,017 - 64,097,938 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ncbp2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	61,925,831 - 61,931,385 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	61,925,831 - 61,931,451 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ncbp2
28 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	204
Count of miRNA genes:	146
Interacting mature miRNAs:	161
Transcripts:	ENSRNOT00000002381, ENSRNOT00000071483
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	56351424	86241447	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	59802794	82566545	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	59802794	82566553	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	60346590	86241447	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	66113321	82169223	Rat
634339	Niddm50	Non-insulin dependent diabetes mellitus QTL 50	3.32		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	66422148	86241447	Rat
1354593	Stl12	Serum triglyceride level QTL 12	3.36		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	11	66422148	86241447	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	37	57	41	19	41	2	2	74	35	41	11	2
Low		6					6	9					6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109525	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598071	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598073	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598074	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC161994	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000002381 ⟹ ENSRNOP00000002381

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,820,734 - 68,829,940 (-)	Ensembl
Rnor_6.0 Ensembl	11	72,071,839 - 72,080,928 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000071483 ⟹ ENSRNOP00000066677

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,817,740 - 68,829,886 (-)	Ensembl
Rnor_6.0 Ensembl	11	72,921,282 - 72,929,003 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098600 ⟹ ENSRNOP00000084122

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,820,734 - 68,851,885 (-)	Ensembl

RefSeq Acc Id:

NM_001109525 ⟹ NP_001102995

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	11	82,326,002 - 82,334,839 (-)	NCBI
mRatBN7.2	11	68,821,026 - 68,829,863 (-)	NCBI
Rnor_6.0	11	72,072,131 - 72,080,968 (-)	NCBI
Rnor_5.0	11	75,147,098 - 75,178,295 (-)	NCBI
RGSC_v3.4	11	70,642,907 - 70,651,744 (-)	RGD
Celera	11	68,243,480 - 68,252,317 (-)	RGD

Sequence:

show sequence

TGGTCCTGCCAGCCTTGGCCGCGTCGTGATTCCTGTTTCTGCATCATGTCGGGTGGCCTCCTGA
AGGCGCTGCGCAGTGACTCCTACGTGGAGCTCAGCGAATACCGGGACCAACACTTCCGGGGTGA
CAATGAAGAACAGGAAAAGTTACTGAAGAAGAGCTGTACGTTGTATGTTGGGAATCTTTCCTTT
TATACAACAGAAGAACAGATTTATGAGCTCTTCAGCAAAAGTGGGGACATAAAGAAGATCATCA
TGGGTCTGGACAAGATGAAGAAAACAGCGTGTGGGTTCTGTTTCGTGGAATACTATTCAAGAGC
AGATGCAGAGAACGCAATGCGGTACATAAACGGAACGCGTCTGGATGACCGGATCATACGGACA
GACTGGGATGCAGGCTTTAAGGAGGGCAGGCAGTATGGACGTGGACGGTCTGGGGGTCAGGTCC
GGGATGAGTATCGGGAGGACTACGATGCTGGAAGAGGCGGCTATGGAAAACTGGCACAAAAACA
GTGAGTGGGCGAGCCCCGAGTACACAGCTCACACACATCAACACAGTTGATGATGGAGAACATC
ACCCAAGGTCTCATCAGTGTCGCAGATGTACGTGAAGCCACTTCTGGTTTTCCTCTGAAATATT
AAAAGACAGAATCCAAAGAATGCCTTTAATTCTAGTCTTATTAGGATGATTTTCTGTTGTTAGG
TCAAAAACTGTATACCTGAGCAACAGACAGTCTGCTGATTAAACTGTCAGCCGGATACCACACT
TGTAGGGAGAGTGGGCAAAATGTCAGAACGGACTTTACAAGCACGTTGGTAAGCTTCATGGGGA
CTGAGATGATTTTCTACATTTTAAGTTTTCATGTTTATCAGTGAGGTCTTGCTACAGTCTATAT
AGCTTTGCTCTAAGTAAGAACAGGTGTGTGTCGACTGGATTTGCCTTTTGTATTTCAGTCTAGT
AGGCACACCAGTCAGTCTTAAATGGTCCTGGGATGCCACGTGCTTCTCTGCTTTATGCATCAGG
ATACTCTCAGGACTTGAGGAGTGCTCACTAAACATTCCTCAAAAGACGCAAATGTTTCACTGAA
AGTTTAAAACAAAACAAAAATAAGGACTTACCCAGAGAGCCTCCGATACCCTAAGTAGGGAGGA
CACTGTCAGTAGGGAATGGAGTGAAAGCTCAAACACTGCCTTGATATGGAAGCTGAGACTGGAA
CCATTAAATTATTCCTTCCCATTCCAAAAGGACCTTAGAATAGAGTGGGCTTTAGAAAAGGGCT
GCACCCAGGCCTGTAATCCCAGCTACTTGGGAGGCTGAAGCAAGAGATCAGCCCGGGGACCTTG
TGAGTCTGCCTCAAGGGTCTACGGAAGGTTCCAGGCACAGTGGTCAGGGGCTTCCTTATTACAT
GAGGGCTCCTGAAAATTAAGAGTATCTAACAACAGAAAGCCTCCTCTAGGATTGTCTGTTATAA
CTGATACACATATTTTAGTCTTTTTTTCTCTGAAATTGTGCTTACTGAGGTCCATGTATTAATA
GTAAGCTAGAAGTCAGTTTCAACAGATTTTTTTTCATTTTCTTTGTATTAT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102995	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI61994	(Get FASTA)	NCBI Sequence Viewer
	B1WC40	(Get FASTA)	NCBI Sequence Viewer
	EDM11452	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000002381.5
	ENSRNOP00000066677.2
	ENSRNOP00000084122.1

RefSeq Acc Id:	NP_001102995 ⟸ NM_001109525
- UniProtKB:	B1WC40 (UniProtKB/Swiss-Prot), A6IRU9 (UniProtKB/TrEMBL), A6IRU8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MSGGLLKALRSDSYVELSEYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTEEQIYELFSKSG DIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFKEGRQYGRG RSGGQVRDEYREDYDAGRGGYGKLAQKQ hide sequence

RefSeq Acc Id:

ENSRNOP00000066677 ⟸ ENSRNOT00000071483

RefSeq Acc Id:

ENSRNOP00000002381 ⟸ ENSRNOT00000002381

RefSeq Acc Id:

ENSRNOP00000084122 ⟸ ENSRNOT00000098600

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B1WC40-F1-model_v2	AlphaFold	B1WC40	1-156	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698219

Promoter ID:

EPDNEW_R8742

Type:

initiation region

Name:

Ncbp2_2

Description:

nuclear cap binding protein subunit 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R8747

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	11	72,080,974 - 72,081,034	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1596188	AgrOrtholog
BioCyc Gene	G2FUF-21075	BioCyc
Ensembl Genes	ENSRNOG00000001746	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000048589	Ensembl
Ensembl Transcript	ENSRNOT00000002381.7	UniProtKB/TrEMBL
	ENSRNOT00000071483.2	UniProtKB/TrEMBL
	ENSRNOT00000098600.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:9034150	IMAGE-MGC_LOAD
InterPro	GPI_mannosylTrfase	UniProtKB/TrEMBL
	NCBP2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NCBP2_RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Nucleotide-bd_a/b_plait_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RRM_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:689116	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:187828	IMAGE-MGC_LOAD
NCBI Gene	689116	ENTREZGENE
PANTHER	NUCLEAR CAP-BINDING PROTEIN SUBUNIT 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR18847	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Glyco_transf_22	UniProtKB/TrEMBL
	RRM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ncbp2	PhenoGen
PROSITE	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000001746	RatGTEx
	ENSRNOG00000048589	RatGTEx
SMART	RRM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6GBG9_RAT	UniProtKB/TrEMBL
	A0A8L2Q0F6_RAT	UniProtKB/TrEMBL
	A0A8L2QXN2_RAT	UniProtKB/TrEMBL
	A6IRU8	ENTREZGENE, UniProtKB/TrEMBL
	A6IRU9	ENTREZGENE, UniProtKB/TrEMBL
	B1WC40	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Ncbp2	nuclear cap binding protein subunit 2	LOC108348149	nuclear cap-binding protein subunit 2-like	Data merged from RGD:11474927	737654	PROVISIONAL
2016-08-02	LOC108348149	nuclear cap-binding protein subunit 2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2015-07-29	Ncbp2	nuclear cap binding protein subunit 2	LOC100911481	nuclear cap-binding protein subunit 2-like	Data merged from RGD:6492837	737654	PROVISIONAL
2012-10-10	Ncbp2	nuclear cap binding protein subunit 2	Pigz	phosphatidylinositol glycan anchor biosynthesis, class Z	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100911481	nuclear cap-binding protein subunit 2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2010-04-23	Pigz	phosphatidylinositol glycan anchor biosynthesis, class Z	LOC689116	similar to nuclear cap binding protein subunit 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC689116	similar to nuclear cap binding protein subunit 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations