Mtx2 (metaxin 2) - Rat Genome Database

Name: Mtx2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Mtx2 (metaxin 2) Mus musculus

Analyze

Symbol:

Mtx2

Name:

metaxin 2

RGD ID:

1315111

MGI Page

MGI

Description:

Predicted to be involved in mitochondrial transport and mitochondrion organization. Predicted to act upstream of or within protein transport. Located in mitochondrion. Is expressed in central nervous system; embryo; and retina. Orthologous to human MTX2 (metaxin 2).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

1500012G02Rik; metaxin-2; mitochondrial outer membrane import complex protein 2

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	MTX2 (metaxin 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Mtx2 (metaxin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Mtx2 (metaxin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	MTX2 (metaxin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	MTX2 (metaxin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Mtx2 (metaxin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	MTX2 (metaxin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	MTX2 (metaxin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Mtx2 (metaxin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Mtx2 (metaxin 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MTX2 (metaxin 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	mtx2 (metaxin 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid\|ZFIN)
Saccharomyces cerevisiae (baker's yeast):	SAM37	Alliance	DIOPT (OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	mtx-2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5662	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG8004	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	mtx2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	74,656,156 - 74,707,092 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	74,656,147 - 74,708,775 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	74,825,812 - 74,876,748 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	74,825,803 - 74,878,431 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	74,663,869 - 74,714,805 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	74,626,690 - 74,679,270 (+)	NCBI		MGSCv36	mm8
Celera	2	76,496,168 - 76,547,115 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Mandibuloacral Dysplasia Progeroid Syndrome (ISO)

megacolon (ISO)

split hand-foot malformation 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (EXP)

17alpha-ethynylestradiol (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-methylcholine (ISO)

6-propyl-2-thiouracil (ISO)

amitrole (ISO)

arsenite(3-) (ISO)

benzene (EXP)

benzo[a]pyrene (EXP)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (ISO)

bisphenol F (ISO)

Brodifacoum (ISO)

cadmium dichloride (ISO)

CGP 52608 (ISO)

copper(II) sulfate (ISO)

dibenzo[a,l]pyrene (EXP)

dicrotophos (ISO)

dioxygen (EXP)

doxorubicin (EXP)

ethanol (EXP)

folic acid (EXP)

fulvestrant (ISO)

ivermectin (ISO)

methidathion (EXP)

methimazole (ISO)

oxaliplatin (ISO)

paracetamol (ISO)

phenytoin (ISO)

pirinixic acid (EXP)

potassium chromate (ISO)

sodium arsenite (EXP)

sulfadimethoxine (ISO)

topotecan (ISO)

tungsten (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

mitochondrial transport (ISO)

mitochondrion organization (IBA)

protein transport (IEA)

Cellular Component

cytoplasm (IBA)

membrane (IEA)

mitochondrial outer membrane (IEA)

mitochondrion (HDA,ISO)

nucleolus (ISO)

SAM complex (IBA,ISO)

Molecular Function

molecular_function (ND)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

beta-barrel pathway of mitochondrial protein import (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

decreased circulating glucose level (IEA)

decreased leukocyte cell number (IEA)

embryonic lethality prior to organogenesis (IEA)

increased bone mineral density (IEA)

preweaning lethality, complete penetrance (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Assembly of beta-barrel proteins in the mitochondrial outer membrane.	Hohr AI, etal., Biochim Biophys Acta. 2015 Jan;1853(1):74-88. doi: 10.1016/j.bbamcr.2014.10.006. Epub 2014 Oct 8.
2.	Functional annotation of a full-length mouse cDNA collection.	Kawai J, etal., Nature. 2001 Feb 8;409(6821):685-90.
3.	MGDs mouse GO annotations	MGD data from the GO Consortium
4.	Integrated analysis of protein composition, tissue diversity, and gene regulation in mouse mitochondria.	Mootha VK, etal., Cell 2003 Nov 26;115(5):629-40.
5.	Analysis of the mouse transcriptome based on functional annotation of 60,770 full-length cDNAs.	Okazaki Y, etal., Nature. 2002 Dec 5;420(6915):563-73.
6.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10349636	PMID:10381257	PMID:11042159	PMID:11076861	PMID:12477932	PMID:12520002	PMID:12904583	PMID:14610273	PMID:15226823	PMID:15489334	PMID:15782199	PMID:16141072
PMID:16141073	PMID:16919269	PMID:17660561	PMID:18614015	PMID:21267068	PMID:21873635	PMID:23375831	PMID:24789282	PMID:26465331	PMID:26496610	PMID:30475793	PMID:32581705
PMID:36476853	PMID:38250156

Genomics

Comparative Map Data

Mtx2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	74,656,156 - 74,707,092 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	74,656,147 - 74,708,775 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	74,825,812 - 74,876,748 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	74,825,803 - 74,878,431 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	74,663,869 - 74,714,805 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	74,626,690 - 74,679,270 (+)	NCBI		MGSCv36	mm8
Celera	2	76,496,168 - 76,547,115 (+)	NCBI		Celera
Cytogenetic Map	2	C3	NCBI
cM Map	2	44.13	NCBI

MTX2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	176,269,442 - 176,338,025 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	176,269,395 - 176,338,025 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	177,134,170 - 177,202,753 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	176,842,383 - 176,910,999 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	176,959,643 - 177,028,258	NCBI
Celera	2	170,743,298 - 170,811,933 (+)	NCBI		Celera
Cytogenetic Map	2	q31.1	NCBI
HuRef	2	169,011,032 - 169,079,657 (+)	NCBI		HuRef
CHM1_1	2	177,139,996 - 177,208,619 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	176,757,567 - 176,826,151 (+)	NCBI		T2T-CHM13v2.0

Mtx2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	80,137,556 - 80,199,547 (+)	NCBI		GRCr8
mRatBN7.2	3	59,730,206 - 59,792,202 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	59,730,197 - 59,792,201 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	63,117,225 - 63,179,188 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	71,700,873 - 71,762,834 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	69,465,936 - 69,527,955 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	61,756,109 - 61,818,999 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	61,756,148 - 61,818,998 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	68,216,558 - 68,279,582 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	57,460,900 - 57,523,379 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	57,357,271 - 57,419,750 (+)	NCBI
Celera	3	59,247,074 - 59,309,016 (+)	NCBI		Celera
Cytogenetic Map	3	q23	NCBI

Mtx2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955403	20,359,527 - 20,412,742 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955403	20,359,524 - 20,412,473 (-)	NCBI	ChiLan1.0	ChiLan1.0

MTX2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	78,938,063 - 79,001,361 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	78,953,051 - 79,016,335 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	63,550,345 - 63,613,626 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	181,258,622 - 181,321,912 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	181,258,622 - 181,321,912 (+)	Ensembl	panpan1.1		panPan2

MTX2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	36	20,067,577 - 20,134,303 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	36	20,067,424 - 20,390,053 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	36	20,088,010 - 20,143,656 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	36	20,220,108 - 20,276,530 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	36	20,209,088 - 20,276,367 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	36	20,293,892 - 20,349,526 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	36	20,294,474 - 20,350,096 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	36	20,406,105 - 20,461,748 (+)	NCBI		UU_Cfam_GSD_1.0

Mtx2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	137,189,131 - 137,245,686 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936509	5,742,987 - 5,799,652 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936509	5,743,004 - 5,799,326 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

MTX2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	82,061,385 - 82,139,072 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	82,061,381 - 82,139,073 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	91,528,880 - 91,635,859 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

MTX2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	61,845,509 - 61,914,661 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	61,845,564 - 61,917,012 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	137,695,873 - 137,765,883 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Mtx2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624787	13,398,713 - 13,459,695 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624787	13,399,293 - 13,459,819 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Mtx2
911 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	721
Count of miRNA genes:	469
Interacting mature miRNAs:	532
Transcripts:	ENSMUST00000028511, ENSMUST00000129284, ENSMUST00000155844
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1301769	Orgwq2_m	organ weight QTL 2 (mouse)			Not determined		2	3887126	93421651	Mouse
1357881	Estoq1_m	embryo survival total QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357454	Kidq1_m	kidney weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357436	Splq1_m	spleen weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
39128209	Lwq14_m	liver weight QTL 14 (mouse)					2	20897778	118894840	Mouse
1558899	Egq1_m	early growth QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1558966	W10q9_m	weight 10 weeks QTL 9 (mouse)			Not determined		2	20897778	118894840	Mouse
1558915	W3q1_m	weight 3 weeks QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1558738	W6q1_m	weight 6 weeks QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1357681	Hrtq1_m	heart weight QTL 1 (mouse)			Not determined		2	20897778	118894840	Mouse
1302174	Dssc2_m	dextran sodium sulfate induced colitis QTL2 (mouse)			Not determined		2	24224632	148700377	Mouse
1300577	Capsq1_m	capsaicin sensitivity related QTL 1 (mouse)			Not determined		2	27602060	84013384	Mouse
4141854	T2dm2sa_m	type 2 diabetes mellitus 2 in SMXA RI mice (mouse)			Not determined		2	29307947	148374934	Mouse
4141236	Hbnr5_m	Heligmosomoides bakeri nematode resistance 5 (mouse)			Not determined			31214567	105143570	Mouse
1301109	Dntcs2_m	dental caries susceptibility 2 (mouse)			Not determined		2	40885493	114910165	Mouse
1301480	Pbwg1_m	postnatal body weight growth 1 (mouse)			Not determined		2	41820719	75820843	Mouse
4141069	Pbwg1.5_m	postnatal body weight growth 1.5 (mouse)			Not determined			43520612	77520756	Mouse
1300788	Cia2_m	collagen induced arthritis QTL 2 (mouse)			Not determined		2	43520612	77520756	Mouse
1300671	Cia4_m	collagen induced arthritis QTL 4 (mouse)			Not determined		2	43520612	77520756	Mouse
1301402	Ap2q_m	alcohol preference 2 QTL (mouse)			Not determined		2	43520612	77520756	Mouse
1301411	Pitm1_m	prion incubation time 1 (mouse)			Not determined		2	43520612	77520756	Mouse
10755532	Lymph5_m	lymphocyte differential 5 (mouse)					2	44199017	78199017	Mouse
1301344	Lith1_m	lithogenic gene 1 (mouse)			Not determined		2	45347635	145312647	Mouse
11532740	Pbwg1.10_m	postnatal body weight growth 1.10 (mouse)					2	48132412	82132495	Mouse
1558820	Moo1_m	modifier of Odc1 (mouse)			Not determined		17	48269746	82269934	Mouse
1301747	Eae21_m	experimental allergic encephalomyelitis 21 (mouse)			Not determined		2	48269746	82269934	Mouse
1301235	Alcw4_m	alcohol withdrawal 4 (mouse)			Not determined		2	48269746	82269934	Mouse
1300568	Hdl1_m	high density lipoprotein (HDL) level 1 (mouse)			Not determined		2	48269746	82269934	Mouse
10755526	Lymph1_m	lymphocyte differential 1 (mouse)					2	50819314	84819314	Mouse
1300875	Taste1_m	taste-saccharin preference 1 (mouse)			Not determined		2	50923175	84923278	Mouse
1300761	Lgth1_m	body length 1 (mouse)			Not determined		2	51703276	85703425	Mouse
13464141	Hbbcq3_m	hemoglobin concentration QTL 3 (mouse)					2	52448019	86448136	Mouse
13463471	Hctq6_m	hematocrit QTL 6 (mouse)					2	52448019	86448136	Mouse
4141406	Alpq2_m	alcohol preference QTL 2 (mouse)			Not determined		2	57524117	91524288	Mouse
12738429	Lfibq18_m	liver fibrosis QTL 18 (mouse)					2	57919991	91919991	Mouse
1357577	Trmq3_m	T cell ratio modifier QTL 3 (mouse)			Not determined		2	60520612	119355518	Mouse
13824983	Vclq1_m	curvilinear velocity QTL 1 (mouse)					2	61830344	136841920	Mouse
10044002	Hdl7_m	HDL level 7 (mouse)			Not determined		2	63005954	97006113	Mouse
10053681	Lith24_m	lithogenic gene 24 (mouse)			Not determined		2	63005954	97006113	Mouse
1301405	Etohr_m	ethanol response acute (mouse)			Not determined		2	63005954	97006113	Mouse
1301703	Bomd3_m	bone mineral density 3 (mouse)			Not determined		2	63005954	97006113	Mouse
1300662	Etohila_m	ethanol induced locomotor activity (mouse)			Not determined		2	63005954	97006113	Mouse
1301048	Actre2_m	activity response to ethanol 2 (mouse)			Not determined		2	63005954	97006113	Mouse
1301873	Hsl1_m	hyperoxia susceptibility locus 1 (mouse)			Not determined		2	63570154	97570301	Mouse
5491197	Mobq5_m	multigenic obesity QTL 5 (mouse)			Not determined		2	65269746	162518926	Mouse
1301059	Hrtfm1_m	heart failure modifier 1 (mouse)			Not determined		2	67591940	74964933	Mouse
1301660	Iba1_m	induction of brown adipocytes 1 (mouse)			Not determined		2	67647887	101648142	Mouse
13463482	Mchq17_m	mean corpuscular hemoglobin QTL 17 (mouse)					2	67647887	101648142	Mouse
1301882	Etohc2_m	ethanol consumption 2 (mouse)			Not determined		2	68724269	102724407	Mouse
1301948	Elsgp3_m	elevated serum gp70 3 (mouse)			Not determined		2	68724269	102724407	Mouse
4142088	Parms1_m	patched associated RMS 1 (mouse)			Not determined			74524117	114123532	Mouse
11528549	Sluc31_m	susceptibility to lung cancer 31 (mouse)					2	74524117	129213005	Mouse

Markers in Region

Mtx2

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	2	74,876,447 - 74,877,397	UniSTS	GRCm38
MGSCv37	2	74,714,504 - 74,715,454	UniSTS	GRCm37
Celera	2	76,546,814 - 76,547,764	UniSTS
Cytogenetic Map	2	D	UniSTS
cM Map	2		UniSTS

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_016804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB041562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF053550	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK005233	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK083055	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK087933	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK168000	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK168021	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK168045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK169048	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK179720	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK179764	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK179988	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK180612	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK207939	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK208117	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK209045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK211256	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK212612	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK212919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK214537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK214538	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK216047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK218920	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK219408	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK220102	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL928733	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL935170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY902354	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC006641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BY126313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSMUST00000028511 ⟹ ENSMUSP00000028511

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	74,656,147 - 74,708,775 (+)	Ensembl
GRCm38.p6 Ensembl	2	74,825,803 - 74,878,431 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000129284

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	74,699,325 - 74,706,848 (+)	Ensembl
GRCm38.p6 Ensembl	2	74,868,981 - 74,876,504 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000155844

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	74,656,174 - 74,699,158 (+)	Ensembl
GRCm38.p6 Ensembl	2	74,825,830 - 74,868,814 (+)	Ensembl

RefSeq Acc Id:

NM_016804 ⟹ NP_058084

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	74,656,156 - 74,707,092 (+)	NCBI
GRCm38	2	74,825,812 - 74,876,748 (+)	ENTREZGENE
MGSCv37	2	74,663,869 - 74,714,805 (+)	RGD
Celera	2	76,496,168 - 76,547,115 (+)	RGD
cM Map	2		ENTREZGENE

Sequence:

show sequence

GCGACGCCGGAAGTGCTTGGTCGGCCTGGCGGTAACCTTGCGGGCCGAGCCACCGCTGCCGAGG
TGAGCTCTGCTCGTCTTAGCGTTGGCCCAGCGAAGCTCGTCAGCTGCCGGGGGAAGGCCGCCGA
GGTCGCGCGGGAGGGCGCCGAGCGCCGCGGAGCTCAGGCGCGCGCGCAGGACCTCGCAGCCGAC
ATGTCTCTGGTGGCGGAAGCGTTCGTCTCCCAGATCGCAGCTACAGAACCTTGGCCTGAAAATG
CGACCTTGTATCAGCAACTGAGAGGGGAGCAAATTTTGCTTTCTGACAATGCAGCATCTCTTGC
TGTGCAGGCATTTTTGCAGATGTGTAATCTGCCTGTCAAAGTGGTGTGTAGGGCAAATGCGGAA
TATATGTCTCCATCTGGAAAAGTTCCTTTTATTCATGTGGGAAATCAAGTAGTGTCAGAACTTG
GCCCAATAGTCCAATTTGTTAAAGCCAAGGGCCATTCTCTTAGTGATGGGTTGGATGAAGTCCA
AAAAGCAGAAATGAAAGCCTACATGGAATTAGTCAACAATATGCTGCTGACTGCAGAGCTGTAT
CTCCAGTGGTGTGATGAAGCTACAGTAGGGGAGATCACTATTGCTAGGTATGGATCTCCTTACC
CTTGGCCTCTGAACCACATTTTGGCCTATCAGAAGCAGTGGGAAGTGAAACGTAAGATGAAAGC
TATTGGATGGGGTAACAAGACTCTGGACCAGGTCTTAGAAGATGTAGACCAGTGCTGTCAAGCC
CTTTCCCAGAGACTGGGAACACAACCATACTTCTTCAATAAGCAACCTACTGAACTTGACGCTC
TGGTTTTTGGCCATTTGTATACCATTCTTACCACACAATTGACCAGCGATGAACTTTCTGAGAA
GGTGAAAAACTATAGCAACCTCCTGGCTTTCTGTAGAAGAATTGAACAGCACTACTTTGAAGAC
TGGGGTAAAGGCAGGTTGTCTTAGAGCCATATACCAATTAGATATTTTAAAAAAAACCTAACTT
TTGAAATATGTATTACTTGAACAATATGGTAGTAGTTGCAGGATCTCAAAACCAAAACCACTGT
TTTTTGAAACCTCAAAAAATTTGCATAATGTCATATACATGTCCTTTGTACTGTTATTTGTGTA
CACTTTGCTTTTGAATTGTTTGATTTGTTACATTAAATTCTATATCTTGACATTTTCTTTCTTT
ATGAGCATATAAAAATAAACCTTAAGCAACTGAGTTTGTTTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_058084	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC25104	(Get FASTA)	NCBI Sequence Viewer
	AAH06641	(Get FASTA)	NCBI Sequence Viewer
	AAY21064	(Get FASTA)	NCBI Sequence Viewer
	BAA95046	(Get FASTA)	NCBI Sequence Viewer
	BAC38747	(Get FASTA)	NCBI Sequence Viewer
	BAC40046	(Get FASTA)	NCBI Sequence Viewer
	BAE39989	(Get FASTA)	NCBI Sequence Viewer
	BAE40006	(Get FASTA)	NCBI Sequence Viewer
	BAE40027	(Get FASTA)	NCBI Sequence Viewer
	BAE40836	(Get FASTA)	NCBI Sequence Viewer
	EDL27182	(Get FASTA)	NCBI Sequence Viewer
	EDL27183	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000028511
	ENSMUSP00000028511.8
GenBank Protein	O88441	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058084 ⟸ NM_016804

- UniProtKB:

Q3TFR2 (UniProtKB/Swiss-Prot), O88441 (UniProtKB/Swiss-Prot), Q3TI19 (UniProtKB/TrEMBL), Q3TI40 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSLVAEAFVSQIAATEPWPENATLYQQLRGEQILLSDNAASLAVQAFLQMCNLPVKVVCRANAE
YMSPSGKVPFIHVGNQVVSELGPIVQFVKAKGHSLSDGLDEVQKAEMKAYMELVNNMLLTAELY
LQWCDEATVGEITIARYGSPYPWPLNHILAYQKQWEVKRKMKAIGWGNKTLDQVLEDVDQCCQA
LSQRLGTQPYFFNKQPTELDALVFGHLYTILTTQLTSDELSEKVKNYSNLLAFCRRIEQHYFED
WGKGRLS

hide sequence

RefSeq Acc Id:

ENSMUSP00000028511 ⟸ ENSMUST00000028511

Protein Domains

Metaxin glutathione S-transferase Mitochondrial outer membrane transport complex

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88441-F1-model_v2	AlphaFold	O88441	1-263	view protein structure

Promoters

RGD ID:

6831860

Promoter ID:

MM_KWN:29771

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

3T3L1_Day0, 3T3L1_Day1, 3T3L1_Day2, 3T3L1_Day3, 3T3L1_Day4, 3T3L1_Day6, BoneMarrow_0Hour, BoneMarrow_2Hour, BoneMarrow_4Hour, Brain, ES_Cell, Kidney, Liver, Lung, MEF_B4, MEF_B6

Transcripts:

OTTMUST00000040110, OTTMUST00000040111

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	2	74,663,724 - 74,664,224 (+)	MPROMDB

RGD ID:

6877684

Promoter ID:

EPDNEW_M2292

Type:

initiation region

Name:

Mtx2_1

Description:

Mus musculus metaxin 2 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	2	74,825,817 - 74,825,877	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1859652	AgrOrtholog
Ensembl Genes	ENSMUSG00000027099	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000028511	ENTREZGENE
	ENSMUST00000028511.8	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1050.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glutaredoxin	UniProtKB/TrEMBL
InterPro	Glutathione-S-Trfase_C_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Glutathione_S-Trfase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Metaxin_GST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sam37/metaxin_N	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:53375	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:1859652	ENTREZGENE
NCBI Gene	53375	ENTREZGENE
PANTHER	METAXIN RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	METAXIN-2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	GST_C_6	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Tom37	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Mtx2	PhenoGen
Superfamily-SCOP	SSF47616	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	MTX2_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q2M4G1_MOUSE	UniProtKB/TrEMBL
	Q3TFR2	ENTREZGENE
	Q3TI19	ENTREZGENE, UniProtKB/TrEMBL
	Q3TI40	ENTREZGENE, UniProtKB/TrEMBL
	Q8C454_MOUSE	UniProtKB/TrEMBL
UniProt Secondary	Q3TFR2	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Mammalian Phenotype