Symbol:
Tmem132a
Name:
transmembrane protein 132A
RGD ID:
727936
Description:
Predicted to enable protein homodimerization activity. Involved in cellular response to hydrogen peroxide and negative regulation of programmed cell death. Predicted to be located in plasma membrane. Predicted to be active in endoplasmic reticulum. Orthologous to human TMEM132A (transmembrane protein 132A); INTERACTS WITH 2,6-dinitrotoluene; ammonium chloride; bisphenol A.
Type:
protein-coding
RefSeq Status:
VALIDATED
Previously known as:
Gbp; GRP78 binding protein; GRP78-binding protein; heat shock 70kDa protein 5 binding protein 1; HSPA5-binding protein 1; Hspa5bp1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 216,931,962 - 216,943,644 (-) NCBI GRCr8 mRatBN7.2 1 207,507,074 - 207,518,756 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 207,507,077 - 207,518,758 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 215,882,163 - 215,893,452 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 222,942,755 - 222,954,168 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 215,636,551 - 215,647,840 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 226,912,562 - 226,925,023 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 226,912,612 - 226,924,244 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 233,978,111 - 233,989,805 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 213,356,270 - 213,367,559 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 213,514,699 - 213,525,989 (-) NCBI Celera 1 204,999,909 - 205,011,198 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Tmem132a Rat 1,2-dimethylhydrazine multiple interactions ISO Tmem132a (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of TMEM132A mRNA CTD PMID:22206623 Tmem132a Rat 17alpha-ethynylestradiol affects expression ISO Tmem132a (Mus musculus) 6480464 Ethinyl Estradiol affects the expression of TMEM132A mRNA CTD PMID:17555576 Tmem132a Rat 17alpha-ethynylestradiol multiple interactions ISO Tmem132a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TMEM132A mRNA CTD PMID:17942748 Tmem132a Rat 17alpha-ethynylestradiol increases expression ISO Tmem132a (Mus musculus) 6480464 Ethinyl Estradiol results in increased expression of TMEM132A mRNA CTD PMID:17942748 Tmem132a Rat 17beta-estradiol multiple interactions ISO TMEM132A (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TMEM132A mRNA and [Estradiol co-treated with TGFB1 protein] results in increased expression of TMEM132A mRNA CTD PMID:20660070 and PMID:30165855 Tmem132a Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Tmem132a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of TMEM132A mRNA CTD PMID:19465110 Tmem132a Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Tmem132a (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of TMEM132A mRNA CTD PMID:15328365 and PMID:17942748 Tmem132a Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO Tmem132a (Mus musculus) 6480464 [Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of TMEM132A mRNA CTD PMID:17942748 Tmem132a Rat 2,6-dinitrotoluene affects expression EXP 6480464 2 and 6-dinitrotoluene affects the expression of TMEM132A mRNA CTD PMID:21346803 Tmem132a Rat 3,4-methylenedioxymethamphetamine increases expression ISO Tmem132a (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of TMEM132A mRNA CTD PMID:20188158 Tmem132a Rat 4-hydroxyphenyl retinamide increases expression ISO Tmem132a (Mus musculus) 6480464 Fenretinide results in increased expression of TMEM132A mRNA CTD PMID:28973697 Tmem132a Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of TMEM132A mRNA CTD PMID:16483693 Tmem132a Rat aristolochic acid A increases expression ISO TMEM132A (Homo sapiens) 6480464 aristolochic acid I results in increased expression of TMEM132A mRNA CTD PMID:33212167 Tmem132a Rat beta-lapachone decreases expression ISO TMEM132A (Homo sapiens) 6480464 beta-lapachone results in decreased expression of TMEM132A mRNA CTD PMID:38218311 Tmem132a Rat bis(2-ethylhexyl) phthalate decreases expression ISO Tmem132a (Mus musculus) 6480464 Diethylhexyl Phthalate results in decreased expression of TMEM132A mRNA CTD PMID:28085963 and PMID:34319233 Tmem132a Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of TMEM132A mRNA CTD PMID:25181051 Tmem132a Rat bisphenol A increases expression ISO Tmem132a (Mus musculus) 6480464 bisphenol A results in increased expression of TMEM132A mRNA CTD PMID:32156529 Tmem132a Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of TMEM132A mRNA CTD PMID:30816183 more ... Tmem132a Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of TMEM132A gene CTD PMID:28505145 Tmem132a Rat cadmium atom increases expression ISO TMEM132A (Homo sapiens) 6480464 Cadmium results in increased expression of TMEM132A mRNA CTD PMID:24376830 Tmem132a Rat cadmium dichloride increases expression ISO TMEM132A (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of TMEM132A mRNA CTD PMID:38568856 Tmem132a Rat caffeine decreases phosphorylation ISO TMEM132A (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of TMEM132A protein CTD PMID:35688186 Tmem132a Rat carbon nanotube affects expression ISO Tmem132a (Mus musculus) 6480464 Nanotubes and Carbon affects the expression of TMEM132A mRNA CTD PMID:25554681 Tmem132a Rat chlordecone increases expression ISO Tmem132a (Mus musculus) 6480464 Chlordecone results in increased expression of TMEM132A mRNA CTD PMID:33711761 Tmem132a Rat choline multiple interactions ISO Tmem132a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TMEM132A mRNA CTD PMID:20938992 Tmem132a Rat copper(II) chloride increases expression ISO TMEM132A (Homo sapiens) 6480464 cupric chloride results in increased expression of TMEM132A mRNA CTD PMID:38568856 Tmem132a Rat DDE decreases expression ISO TMEM132A (Homo sapiens) 6480464 Dichlorodiphenyl Dichloroethylene results in decreased expression of TMEM132A mRNA CTD PMID:38568856 Tmem132a Rat dexamethasone decreases expression ISO TMEM132A (Homo sapiens) 6480464 Dexamethasone results in decreased expression of TMEM132A mRNA CTD PMID:25047013 Tmem132a Rat doxorubicin decreases expression ISO TMEM132A (Homo sapiens) 6480464 Doxorubicin results in decreased expression of TMEM132A mRNA CTD PMID:29803840 Tmem132a Rat endosulfan decreases expression EXP 6480464 Endosulfan results in decreased expression of TMEM132A mRNA CTD PMID:29391264 Tmem132a Rat ethanol multiple interactions ISO Tmem132a (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of TMEM132A mRNA CTD PMID:30319688 Tmem132a Rat ethanol affects expression ISO Tmem132a (Mus musculus) 6480464 Ethanol affects the expression of TMEM132A mRNA CTD PMID:30319688 Tmem132a Rat folic acid multiple interactions ISO Tmem132a (Mus musculus) 6480464 [1 more ... CTD PMID:20938992 and PMID:22206623 Tmem132a Rat FR900359 increases phosphorylation ISO TMEM132A (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of TMEM132A protein CTD PMID:37730182 Tmem132a Rat furan decreases expression EXP 6480464 furan results in decreased expression of TMEM132A mRNA CTD PMID:25539665 Tmem132a Rat L-methionine multiple interactions ISO Tmem132a (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased expression of TMEM132A mRNA CTD PMID:20938992 Tmem132a Rat maneb multiple interactions ISO Tmem132a (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of TMEM132A mRNA CTD PMID:36117858 Tmem132a Rat methylparaben increases expression ISO TMEM132A (Homo sapiens) 6480464 methylparaben results in increased expression of TMEM132A mRNA CTD PMID:38568856 Tmem132a Rat O-methyleugenol increases expression ISO TMEM132A (Homo sapiens) 6480464 methyleugenol results in increased expression of TMEM132A mRNA CTD PMID:32234424 Tmem132a Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TMEM132A mRNA CTD PMID:25729387 Tmem132a Rat ozone multiple interactions ISO Tmem132a (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of TMEM132A mRNA CTD PMID:34911549 Tmem132a Rat paracetamol increases expression ISO TMEM132A (Homo sapiens) 6480464 Acetaminophen results in increased expression of TMEM132A mRNA CTD PMID:29067470 Tmem132a Rat paraquat multiple interactions ISO Tmem132a (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in decreased expression of TMEM132A mRNA CTD PMID:36117858 Tmem132a Rat perfluorodecanoic acid decreases expression ISO TMEM132A (Homo sapiens) 6480464 perfluorodecanoic acid results in decreased expression of TMEM132A mRNA CTD PMID:38568856 Tmem132a Rat perfluorononanoic acid decreases expression ISO TMEM132A (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in decreased expression of TMEM132A mRNA CTD PMID:38568856 Tmem132a Rat progesterone multiple interactions ISO TMEM132A (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of TMEM132A mRNA CTD PMID:20660070 Tmem132a Rat propylparaben increases expression ISO TMEM132A (Homo sapiens) 6480464 propylparaben results in increased expression of TMEM132A mRNA CTD PMID:38568856 Tmem132a Rat resveratrol multiple interactions ISO TMEM132A (Homo sapiens) 6480464 [Plant Extracts co-treated with Resveratrol] results in decreased expression of TMEM132A mRNA CTD PMID:23557933 Tmem132a Rat rotenone decreases expression EXP 6480464 Rotenone results in decreased expression of TMEM132A mRNA CTD PMID:19013527 Tmem132a Rat S-(1,2-dichlorovinyl)-L-cysteine decreases expression ISO TMEM132A (Homo sapiens) 6480464 S-(1 and 2-dichlorovinyl)cysteine results in decreased expression of TMEM132A mRNA CTD PMID:35811015 Tmem132a Rat tamoxifen affects expression ISO Tmem132a (Mus musculus) 6480464 Tamoxifen affects the expression of TMEM132A mRNA CTD PMID:17555576 Tmem132a Rat temozolomide increases expression ISO TMEM132A (Homo sapiens) 6480464 Temozolomide results in increased expression of TMEM132A mRNA CTD PMID:31758290 Tmem132a Rat tert-butyl hydroperoxide increases expression ISO TMEM132A (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of TMEM132A mRNA CTD PMID:15336504 Tmem132a Rat tetrachloromethane affects expression ISO Tmem132a (Mus musculus) 6480464 Carbon Tetrachloride affects the expression of TMEM132A mRNA CTD PMID:17484886 Tmem132a Rat thioacetamide decreases expression EXP 6480464 Thioacetamide results in decreased expression of TMEM132A mRNA CTD PMID:34492290 Tmem132a Rat titanium dioxide decreases methylation ISO Tmem132a (Mus musculus) 6480464 titanium dioxide results in decreased methylation of TMEM132A gene CTD PMID:35295148 Tmem132a Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of TMEM132A mRNA CTD PMID:25729387 Tmem132a Rat trichloroethene affects expression ISO Tmem132a (Mus musculus) 6480464 Trichloroethylene affects the expression of TMEM132A mRNA CTD PMID:21135412 Tmem132a Rat valdecoxib increases expression EXP 6480464 valdecoxib results in increased expression of TMEM132A mRNA CTD PMID:24136188 Tmem132a Rat zoledronic acid increases expression ISO TMEM132A (Homo sapiens) 6480464 zoledronic acid results in increased expression of TMEM132A mRNA CTD PMID:24714768
1.
Mitochondrial calcium-mediated reactive oxygen species are essential for the rapid induction of the grp78 gene in 9L rat brain tumour cells.
Chang WM, etal., Cell Signal 2003 Jan;15(1):57-64.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Dexmedetomidine attenuates H2O2-induced neonatal rat cardiomyocytes apoptosis through mitochondria- and ER-medicated oxidative stress pathways.
Liu XR, etal., Mol Med Rep. 2018 May;17(5):7258-7264. doi: 10.3892/mmr.2018.8751. Epub 2018 Mar 15.
4.
NCBI rat LocusLink and RefSeq merged data October 15, 2003
NCBI rat LocusLink and RefSeq merged data October 15, 2003
5.
Cloning and characterization of a novel GRP78-binding protein in the rat brain.
Oh-hashi K, etal., J Biol Chem 2003 Mar 21;278(12):10531-7. Epub 2003 Jan 3.
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
Tmem132a Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 1 216,931,962 - 216,943,644 (-) NCBI GRCr8 mRatBN7.2 1 207,507,074 - 207,518,756 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 1 207,507,077 - 207,518,758 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 1 215,882,163 - 215,893,452 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 1 222,942,755 - 222,954,168 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 1 215,636,551 - 215,647,840 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 1 226,912,562 - 226,925,023 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 1 226,912,612 - 226,924,244 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 233,978,111 - 233,989,805 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 1 213,356,270 - 213,367,559 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 1 213,514,699 - 213,525,989 (-) NCBI Celera 1 204,999,909 - 205,011,198 (-) NCBI Celera Cytogenetic Map 1 q43 NCBI
TMEM132A Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 11 60,924,460 - 60,937,159 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 11 60,924,460 - 60,937,159 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 11 60,691,932 - 60,704,631 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 11 60,448,489 - 60,461,207 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Celera 11 58,052,800 - 58,065,518 (+) NCBI Celera Cytogenetic Map 11 q12.2 NCBI HuRef 11 57,038,081 - 57,050,800 (+) NCBI HuRef CHM1_1 11 60,558,217 - 60,570,931 (+) NCBI CHM1_1 T2T-CHM13v2.0 11 60,875,611 - 60,888,306 (+) NCBI T2T-CHM13v2.0
Tmem132a Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 19 10,835,193 - 10,847,569 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 19 10,835,186 - 10,847,304 (-) Ensembl GRCm39 Ensembl GRCm38 19 10,857,829 - 10,870,205 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 19 10,857,822 - 10,869,940 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 19 10,932,319 - 10,944,269 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 19 10,924,874 - 10,936,824 (-) NCBI MGSCv36 mm8 Celera 19 11,550,897 - 11,562,848 (-) NCBI Celera Cytogenetic Map 19 A NCBI cM Map 19 7.26 NCBI
Tmem132a Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955511 5,567,415 - 5,574,522 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955511 5,567,413 - 5,574,759 (+) NCBI ChiLan1.0 ChiLan1.0
TMEM132A Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 9 62,093,725 - 62,106,412 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 11 63,137,762 - 63,150,456 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 11 56,187,444 - 56,200,353 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 11 59,628,353 - 59,640,910 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 11 59,628,534 - 59,640,658 (+) Ensembl panpan1.1 panPan2
TMEM132A Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 18 55,363,713 - 55,376,227 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 18 55,363,698 - 55,385,587 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 18 53,936,900 - 53,949,410 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 18 56,412,326 - 56,424,636 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 18 56,412,326 - 56,424,601 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 18 55,469,692 - 55,482,178 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 18 55,091,271 - 55,103,648 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 18 55,972,452 - 55,984,779 (-) NCBI UU_Cfam_GSD_1.0
Tmem132a Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 11,883,016 - 11,892,106 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936581 1,995,941 - 2,006,059 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936581 1,996,838 - 2,006,118 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
TMEM132A Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 2 10,814,307 - 10,824,894 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 2 10,814,305 - 10,827,851 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 2 10,341,803 - 10,352,089 (+) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
TMEM132A Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 1 12,910,668 - 12,923,946 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 1 12,910,280 - 12,923,718 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666038 110,279,242 - 110,292,307 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Tmem132a
.
Predicted Target Of
Count of predictions: 56 Count of miRNA genes: 53 Interacting mature miRNAs: 55 Transcripts: ENSRNOT00000028971 Prediction methods: Miranda, Rnahybrid, Targetscan Result types: miRGate_prediction
1578778 Pur4 Proteinuria QTL 4 3.3 0.003 urine total protein amount (VT:0000032) urine total protein excretion rate (CMO:0000756) 1 150700247 252085048 Rat 1354646 Kidm18 Kidney mass QTL 18 5.7 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 151162512 256448636 Rat 1357335 Bw39 Body weight QTL 39 3.3 body mass (VT:0001259) body weight (CMO:0000012) 1 197814409 242814409 Rat 1578780 Cm52 Cardiac mass QTL 52 3.3 0.0001 heart mass (VT:0007028) heart wet weight (CMO:0000069) 1 81591954 219808434 Rat 2302375 Bw83 Body weight QTL 83 4.87 0.0002 body mass (VT:0001259) body weight (CMO:0000012) 1 197697768 242697768 Rat 1354652 Kidm20 Kidney mass QTL 20 4.3 kidney mass (VT:0002707) calculated kidney weight (CMO:0000160) 1 177227632 256448636 Rat 2293674 Bss39 Bone structure and strength QTL 39 7.1 0.0001 femur strength trait (VT:0010010) femur total energy absorbed before break (CMO:0001677) 1 201554356 246554356 Rat 2302378 Insul11 Insulin level QTL 11 3.25 blood insulin amount (VT:0001560) serum insulin level (CMO:0000358) 1 144267353 251128347 Rat 1354653 Despr9 Despair related QTL 9 0.00019 locomotor behavior trait (VT:0001392) amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958) 1 167909849 212909849 Rat 2293673 Bss27 Bone structure and strength QTL 27 18.63 0.0001 femur morphology trait (VT:0000559) femur midshaft cortical cross-sectional area (CMO:0001663) 1 171629477 216629477 Rat 2293677 Bss41 Bone structure and strength QTL 41 9.38 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra cross-sectional area (CMO:0001689) 1 171629477 216629477 Rat 1302787 Stl25 Serum triglyceride level QTL 25 2.7 0.0073 blood triglyceride amount (VT:0002644) plasma triglyceride level (CMO:0000548) 1 180359209 210702199 Rat 1549830 Bss1 Bone structure and strength QTL 1 4.8 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 172609619 217609619 Rat 7794788 Mcs32 Mammary carcinoma susceptibility QTL 32 2.61 mammary gland integrity trait (VT:0010552) mammary tumor incidence/prevalence measurement (CMO:0000946) 1 115540693 238914717 Rat 70163 Bw20 Body weight QTL 20 5.1 body mass (VT:0001259) body weight (CMO:0000012) 1 174133260 219133260 Rat 1578763 Kidm29 Kidney mass QTL 29 3.3 0.0001 kidney mass (VT:0002707) both kidneys wet weight (CMO:0000085) 1 179567751 260522016 Rat 1600395 Niddm69 Non-insulin dependent diabetes mellitus QTL 69 4.14 0.0002 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 195804352 257091168 Rat 1354624 Cm35 Cardiac mass QTL35 5.7 heart left ventricle mass (VT:0007031) calculated heart weight (CMO:0000073) 1 177227632 256448636 Rat 1600396 Niddm68 Non-insulin dependent diabetes mellitus QTL 68 4.97 0.0003 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 1558658 Bw59 Body weight QTL 59 3.5 0.0003 body mass (VT:0001259) body weight (CMO:0000012) 1 178784622 223784622 Rat 1600397 Edcs4 Endometrial carcinoma susceptibility QTL 4 2.2 uterus morphology trait (VT:0001120) percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759) 1 206081677 251081677 Rat 631838 Niddm36 Non-insulin dependent diabetes mellitus QTL 36 0.01 insulin secretion trait (VT:0003564) calculated pancreatic islet insulin release measurement (CMO:0001217) 1 184550676 229550676 Rat 1549837 Hcar15 Hepatocarcinoma resistance QTL 15 0.05 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 153136852 260522016 Rat 2293689 Bss47 Bone structure and strength QTL 47 7.25 0.0001 lumbar vertebra size trait (VT:0010518) lumbar vertebra trabecular cross-sectional area (CMO:0001692) 1 171629477 216629477 Rat 152025235 Bw194 Body weight QTL 194 4.86 body mass (VT:0001259) 1 123556856 242907031 Rat 1600388 Niddm67 Non-insulin dependent diabetes mellitus QTL 67 5.84 0.000004 blood glucose amount (VT:0000188) blood glucose level area under curve (AUC) (CMO:0000350) 1 195804352 257091168 Rat 2293694 Bss38 Bone structure and strength QTL 38 7.05 0.0001 femur strength trait (VT:0010010) femur stiffness (CMO:0001674) 1 201554356 246554356 Rat 1598853 Memor3 Memory QTL 3 4.5 exploratory behavior trait (VT:0010471) total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443) 1 143506580 212458660 Rat 61341 Bp26 Blood pressure QTL 26 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 169537671 214537671 Rat 1578759 Uae30 Urinary albumin excretion QTL 30 3.3 0.003 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 150700247 252085048 Rat 2293693 Bss22 Bone structure and strength QTL 22 33.52 0.0001 femur morphology trait (VT:0000559) femur cross-sectional area (CMO:0001661) 1 171629477 216629477 Rat 2300161 Bmd43 Bone mineral density QTL 43 8.4 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 1300145 Rf7 Renal function QTL 7 2.96 urine creatinine amount (VT:0010540) urine creatinine level (CMO:0000125) 1 185145134 221264292 Rat 8655655 Arrd2 Age-related retinal degeneration QTL 2 7.79 retinal layer morphology trait (VT:0003727) percentage of study population developing retinopathy during a period of time (CMO:0002453) 1 183970203 243914901 Rat 1358898 Bp255 Blood pressure QTL 255 3.6 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 191019702 246062233 Rat 631214 Bw61 Body weight QTL61 3.4 0.0001 intramuscular adipose amount (VT:0010044) intramuscular fat area (CMO:0001162) 1 173108781 218108781 Rat 7771612 Cm80 Cardiac mass QTL 80 8.4 heart left ventricle mass (VT:0007031) heart left ventricle weight (CMO:0000776) 1 149448574 221264292 Rat 731168 Bp154 Blood pressure QTL 154 3.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 94642644 214537671 Rat 2300175 Bmd40 Bone mineral density QTL 40 15.4 0.0001 femur mineral mass (VT:0010011) bone mineral density (CMO:0001226) 1 201554356 246554356 Rat 2300174 Bmd42 Bone mineral density QTL 42 8.4 0.0001 lumbar vertebra mineral mass (VT:0010511) bone mineral density (CMO:0001226) 1 171629477 216629477 Rat 737828 Hcas3 Hepatocarcinoma susceptibility QTL 3 4.9 liver integrity trait (VT:0010547) liver tumorous lesion volume to total liver volume ratio (CMO:0001082) 1 144267353 222987745 Rat 1354661 Bw33 Body weight QTL 33 5.2 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1358886 Bp260 Blood pressure QTL 260 3.67 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 151162766 225824951 Rat 737977 Bp160 Blood pressure QTL 160 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 181133855 226133855 Rat 2293654 Bss30 Bone structure and strength QTL 30 32.65 0.0001 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 1 171629477 216629477 Rat 2293655 Bss36 Bone structure and strength QTL 36 10.66 0.0001 femur strength trait (VT:0010010) femur ultimate force (CMO:0001675) 1 201554356 246554356 Rat 1298084 Thym4 Thymus enlargement QTL 4 10.68 thymus mass (VT:0004954) thymus weight to body weight ratio (CMO:0000612) 1 197814409 242814409 Rat 724531 Uae5 Urinary albumin excretion QTL 5 4 urine albumin amount (VT:0002871) urine albumin level (CMO:0000130) 1 150700142 252085212 Rat 2300187 Bmd41 Bone mineral density QTL 41 8.9 0.0001 femur mineral mass (VT:0010011) volumetric bone mineral density (CMO:0001553) 1 171629477 216629477 Rat 8552891 Epfw5 Epididymal fat weight QTL 5 4.4 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 1 193113876 238113876 Rat 1354580 Scort1 Serum corticosterone level QTL 1 3.4 blood corticosterone amount (VT:0005345) blood corticosterone level (CMO:0001172) 1 156677124 256448636 Rat 1358292 Cm37 Cardiac mass QTL 37 6.2 8e-07 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 1 196248093 241248093 Rat 61376 Bp42 Blood pressure QTL 42 23.4 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 197814409 242814409 Rat 634313 Niddm43 Non-insulin dependent diabetes mellitus QTL 43 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 199050459 259647894 Rat 634312 Bp143 Blood pressure QTL 143 3 0.0002 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 182623426 219932796 Rat 1358294 Bw37 Body weight QTL 37 5 0.000011 body mass (VT:0001259) body weight (CMO:0000012) 1 171310381 216310381 Rat 1357399 Bw45 Body weight QTL 45 3.05 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 1 206329708 251329708 Rat 724559 Pancm1 Pancreatic morphology QTL 1 7.1 islet of Langerhans morphology trait (VT:0005215) pancreatic islet damage composite score (CMO:0001156) 1 181759564 214537555 Rat 2312420 Pur17 Proteinuria QTL 17 7.1 0.0001 urine protein amount (VT:0005160) urine total protein excretion rate (CMO:0000756) 1 156677124 218753816 Rat 1357404 Bw42 Body weight QTL 42 4.49 0.0001 body mass (VT:0001259) body weight (CMO:0000012) 1 206329708 251329708 Rat 10059600 Bp378 Blood pressure QTL 378 3.08 0.05 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 176869060 221869060 Rat 7421630 Bp362 Blood pressure QTL 362 0.001 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 118608292 241799120 Rat 619613 Bp77 Blood pressure QTL 77 0.01 arterial blood pressure trait (VT:2000000) diastolic blood pressure (CMO:0000005) 1 164747424 209747424 Rat 2312564 Glom18 Glomerulus QTL 18 2.4 0.003 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 1 185356336 231689108 Rat 634321 Hc1 Hypercalciuria QTL 1 2.91 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 178810256 240830002 Rat 2292218 Kidm35 Kidney mass QTL 35 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 199368955 224569684 Rat 724562 Rends1 Renal damage susceptibility QTL 1 0.05 kidney glomerulus integrity trait (VT:0010546) index of glomerular damage (CMO:0001135) 1 169537671 214537671 Rat 1331790 Bp201 Blood pressure QTL 201 3.127 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 1 198211513 225126682 Rat 10059587 Bw173 Body weight QTL 173 3.23 0.025 body mass (VT:0001259) body weight (CMO:0000012) 1 202069611 247069611 Rat 61403 Niddm4 Non-insulin dependent diabetes mellitus QTL 4 blood glucose amount (VT:0000188) plasma glucose level (CMO:0000042) 1 206329708 222745518 Rat 2292222 Bp307 Blood pressure QTL 307 3.06 0.0014 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 213533942 Rat 2292220 Bp306 Blood pressure QTL 306 3.47 0.00087 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 1 164310393 243914901 Rat 10059590 Kidm44 Kidney mass QTL 44 3.42 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 191033875 236033875 Rat 1641926 Teswt2 Testicular weight QTL 2 2.82 testis mass (VT:1000644) both testes wet weight (CMO:0000175) 1 197697768 238755659 Rat 631658 Cm7 Cardiac mass QTL 7 5.32 0.0001 aorta mass (VT:0002845) aorta weight (CMO:0000076) 1 196248093 241248093 Rat 1600380 Niddm70 Non-insulin dependent diabetes mellitus QTL 70 3.1 0.0008 blood insulin amount (VT:0001560) plasma insulin level (CMO:0000342) 1 176550523 221550523 Rat 1354610 Bw34 Body weight QTL 34 4.1 body mass (VT:0001259) body weight (CMO:0000012) 1 151162512 256448636 Rat 1582206 Kidm33 Kidney mass QTL 33 6.9 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 1 188377360 224054420 Rat 8655855 Arrd3 Age-related retinal degeneration QTL 3 3.07 lens clarity trait (VT:0001304) cataract incidence/prevalence measurement (CMO:0001585) 1 183970203 243914901 Rat 634338 Hcar4 Hepatocarcinoma resistance QTL 4 4.6 liver integrity trait (VT:0010547) liver tumorous lesion number to liver area ratio (CMO:0001210) 1 193422268 214537671 Rat 6903303 Scl34 Serum cholesterol QTL 34 2.5 0.0033 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 1 180359209 218108781 Rat 1600374 Mcs17 Mammary carcinoma susceptibility QTL 17 3 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 1 197670404 242670404 Rat 1600363 Hc6 Hypercalciuria QTL 6 2.7 urine calcium amount (VT:0002985) urine calcium excretion rate (CMO:0000763) 1 203995416 244113296 Rat 2293083 Iddm25 Insulin dependent diabetes mellitus QTL 25 4.18 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 1 181829673 224569684 Rat 1354606 Bp246 Blood pressure QTL 246 3.6 arterial blood pressure trait (VT:2000000) pulse pressure (CMO:0000292) 1 102813953 218753816 Rat 738032 Hcas5 Hepatocarcinoma susceptibility QTL 5 3.12 liver integrity trait (VT:0010547) liver tumorous lesion number (CMO:0001068) 1 176426412 257976495 Rat 1358191 Ept10 Estrogen-induced pituitary tumorigenesis QTL 10 3.8 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 1 192825253 243914732 Rat 7394701 Uae46 Urinary albumin excretion QTL 46 3.6 0.0056 urine albumin amount (VT:0002871) urine albumin excretion rate (CMO:0000757) 1 201554356 246554356 Rat
AI178537
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 207,510,168 - 207,510,258 (+) MAPPER mRatBN7.2 Rnor_6.0 1 226,915,655 - 226,915,744 NCBI Rnor6.0 Rnor_5.0 1 233,981,204 - 233,981,293 UniSTS Rnor5.0 RGSC_v3.4 1 213,359,114 - 213,359,203 UniSTS RGSC3.4 Celera 1 205,002,753 - 205,002,842 UniSTS RH 3.4 Map 1 1509.89 UniSTS Cytogenetic Map 1 q43 UniSTS
RH125077
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 1 207,507,618 - 207,507,734 (+) MAPPER mRatBN7.2 Rnor_6.0 1 226,913,105 - 226,913,220 NCBI Rnor6.0 Rnor_5.0 1 233,978,654 - 233,978,769 UniSTS Rnor5.0 RGSC_v3.4 1 213,356,564 - 213,356,679 UniSTS RGSC3.4 Celera 1 205,000,203 - 205,000,318 UniSTS Cytogenetic Map 1 q43 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000028971 ⟹ ENSRNOP00000037012
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 1 207,507,077 - 207,518,758 (-) Ensembl Rnor_6.0 Ensembl 1 226,912,612 - 226,924,244 (-) Ensembl
RefSeq Acc Id:
NM_001415950 ⟹ NP_001402879
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 216,931,962 - 216,943,644 (-) NCBI mRatBN7.2 1 207,507,074 - 207,518,756 (-) NCBI
RefSeq Acc Id:
NM_178021 ⟹ NP_821140
RefSeq Status:
VALIDATED
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 1 216,931,962 - 216,943,644 (-) NCBI mRatBN7.2 1 207,507,074 - 207,518,756 (-) NCBI Rnor_6.0 1 226,912,811 - 226,924,100 (-) NCBI Rnor_5.0 1 233,978,111 - 233,989,805 (-) NCBI RGSC_v3.4 1 213,356,270 - 213,367,559 (-) RGD Celera 1 204,999,909 - 205,011,198 (-) RGD
Sequence:
ATGACGGAACGTGCGGCAGCGGCCCCTCGGGGGCCCTACGGTGCCTGGCTCTGCCTCCTGGTGGCTCTCGCCCTGGAAGTCGTGAGAGTTGGCAGTAACCAAAATACCCTGGACCCCATCTACCTGCC
hide sequence
RefSeq Acc Id:
NP_821140 ⟸ NM_178021
- Peptide Label:
isoform 2 precursor
- UniProtKB:
Q80WF4 (UniProtKB/Swiss-Prot), G3V963 (UniProtKB/TrEMBL), A6I062 (UniProtKB/TrEMBL)
- Sequence:
MTERAAAAPRGPYGAWLCLLVALALEVVRVGSNQNTLDPIYLPVALELLDAPEHFRVQQVGHYPPANSSLGSRSETFLLMQPWPRAQPLLRASYPPFATQQVVPPRVTEPHRRPVPWDVRAVSVEAAV
hide sequence
Ensembl Acc Id:
ENSRNOP00000037012 ⟸ ENSRNOT00000028971
RefSeq Acc Id:
NP_001402879 ⟸ NM_001415950
- Peptide Label:
isoform 1 precursor
- UniProtKB:
Q80WF4 (UniProtKB/Swiss-Prot)
RGD ID: 13690780 Promoter ID: EPDNEW_R1303 Type: multiple initiation site Name: Tmem132a_1 Description: transmembrane protein 132A SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 1 226,924,242 - 226,924,302 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2008-03-04
Tmem132a
transmembrane protein 132A
Hspa5bp1
heat shock 70kDa protein 5 binding protein 1
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-07-08
Hspa5bp1
heat shock 70kDa protein 5 binding protein 1
Gbp
GRP78 binding protein
Symbol and Name updated
1299863 APPROVED
Note Type
Note
Reference
gene_expression
expressed in neuronal cells in pre- and post-natal developing brain
1299605
gene_regulation
rapid induction in 9L brain tumor cells by okadaic acid (OA) followed by heat shock (HS) requires disrupted mitochondrial calcium homeostasis and reactive oxygen intermediates
1299606
