Advanced Search (OLGA)

Gene: Prlhr (prolactin releasing hormone receptor) Rattus norvegicus

Analyze

Symbol:

Prlhr

Name:

prolactin releasing hormone receptor

RGD ID:

71037

Description:

Enables G protein-coupled receptor activity and peptide hormone binding activity. Involved in G protein-coupled receptor signaling pathway and feeding behavior. Predicted to be located in membrane. Predicted to be active in cilium; neuron projection; and plasma membrane. Used to study obesity. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human PRLHR (prolactin releasing hormone receptor); PARTICIPATES IN obesity pathway; INTERACTS WITH 2,2',5,5'-tetrachlorobiphenyl; 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

G protein-coupled receptor 10; G-protein coupled receptor 10; Gpr10; prolactin-releasing peptide receptor; prRP receptor; prRPR; Uhr-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PRLHR (prolactin releasing hormone receptor)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Prlhr (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Prlhr (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PRLHR (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PRLHR (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Prlhr (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PRLHR (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PRLHR (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Prlhr (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Prlhr (prolactin releasing hormone receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LSM12 (LSM12 homolog)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PRLHR (prolactin releasing hormone receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Prlhr (prolactin releasing hormone receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	prlhr2a (prolactin releasing hormone receptor 2a)	Alliance	DIOPT (InParanoid\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	prlhr2b (prolactin releasing hormone receptor 2b)	Alliance	DIOPT (InParanoid\|OMA\|OrthoInspector\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-10	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	npr-10	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	sNPF-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	sNPF-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-13	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	npr-13	Alliance	DIOPT (Ensembl Compara\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	npr-3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	npr-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Caenorhabditis elegans (roundworm):	npr-5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	npr-5	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	npr-6	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-7	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	prlhr	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	XB982628 [provisional:prlhr]	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)

Is Marker For:

Strains: BN.OLETF-(D1Rat169-D1Rat90)/Got

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	269,592,735 - 269,594,422 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	269,585,611 - 269,594,909 (-)	Ensembl				GRCr8
mRatBN7.2	1	259,606,704 - 259,608,391 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	259,606,704 - 259,608,391 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	267,812,258 - 267,813,943 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	274,518,288 - 274,519,973 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	267,171,127 - 267,172,814 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	281,754,472 - 281,756,159 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	281,754,724 - 281,756,159 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	289,097,316 - 289,099,003 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	267,068,380 - 267,070,067 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	255,251,200 - 255,252,887 (-)	NCBI		Celera
RGSC_v3.1	1	267,279,424 - 267,281,112 (-)	NCBI
Cytogenetic Map	1	q55	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

hypertension (ISO)

obesity (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

2,2',5,5'-tetrachlorobiphenyl (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

4,4'-sulfonyldiphenol (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP)

CGP 52608 (ISO)

chlordecone (ISO)

crocidolite asbestos (ISO)

fentanyl (EXP)

gamma-aminobutyric acid (EXP)

glyphosate (EXP)

Nonylphenol (EXP)

resveratrol (ISO)

sodium arsenite (ISO)

titanium dioxide (ISO)

triptonide (ISO)

troglitazone (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult feeding behavior (ISO)

feeding behavior (IBA,IEA,IMP,ISO)

G protein-coupled receptor signaling pathway (IEA,IMP,ISO)

hormone metabolic process (ISO)

neuropeptide signaling pathway (IBA,IEA)

signal transduction (IEA)

Cellular Component

9+0 non-motile cilium (ISO)

cilium (ISO)

membrane (IEA)

neuron projection (IBA)

plasma membrane (IBA,IEA)

Molecular Function

G protein-coupled receptor activity (IEA,IMP,ISO)

neuropeptide receptor activity (IBA)

neuropeptide Y receptor activity (IEA)

peptide hormone binding (IMP)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

obesity pathway (IMP)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

increased retroperitoneal fat pad weight (IAGP)

obese (IAGP)

polyphagia (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Association between physical activity and blood pressure is modified by variants in the G-protein coupled receptor 10.	Franks PW, etal., Hypertension. 2004 Feb;43(2):224-8. Epub 2003 Dec 22.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Genetic Fine-Mapping and Identification of Candidate Genes and Variants for Adiposity Traits in Outbred Rats.	Keele GR, etal., Obesity (Silver Spring). 2018 Jan;26(1):213-222. doi: 10.1002/oby.22075. Epub 2017 Nov 28.
5.	Gene Data Set	MGD Curation, June 12, 2002
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Expression of neuropeptide FF, prolactin-releasing peptide, and the receptor UHR1/GPR10 genes during embryogenesis in the rat.	Nieminen ML, etal., Dev Dyn 2003 Mar;226(3):561-9.
9.	GOA pipeline	RGD automated data pipeline
10.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Mutated G-protein-coupled receptor GPR10 is responsible for the hyperphagia/dyslipidaemia/obesity locus of Dmo1 in the OLETF rat.	Watanabe TK, etal., Clin Exp Pharmacol Physiol. 2005 May-Jun;32(5-6):355-66.
13.	Sequence and tissue distribution of a candidate G-coupled receptor cloned from rat hypothalamus.	Welch SK, etal., Biochem Biophys Res Commun 1995 Apr 17;209(2):606-13.

Additional References at PubMed

PMID:10498338	PMID:14742914	PMID:15752583	PMID:19540425	PMID:28154160

Genomics

Comparative Map Data

Prlhr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	269,592,735 - 269,594,422 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	1	269,585,611 - 269,594,909 (-)	Ensembl				GRCr8
mRatBN7.2	1	259,606,704 - 259,608,391 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	259,606,704 - 259,608,391 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	1	267,812,258 - 267,813,943 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	274,518,288 - 274,519,973 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	267,171,127 - 267,172,814 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	281,754,472 - 281,756,159 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	281,754,724 - 281,756,159 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	1	289,097,316 - 289,099,003 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	1	267,068,380 - 267,070,067 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	1	255,251,200 - 255,252,887 (-)	NCBI		Celera
RGSC_v3.1	1	267,279,424 - 267,281,112 (-)	NCBI
Cytogenetic Map	1	q55	NCBI

PRLHR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	10	118,589,997 - 118,595,648 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	10	118,589,997 - 118,596,704 (-)	Ensembl			hg38	GRCh38
GRCh37	10	120,349,509 - 120,355,160 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	10	120,342,906 - 120,345,150 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	10	120,343,633 - 120,344,746	NCBI
Celera	10	114,083,566 - 114,085,810 (-)	NCBI		Celera
Cytogenetic Map	10	q26.11	NCBI
HuRef	10	113,981,999 - 113,984,243 (-)	NCBI		HuRef
CHM1_1	10	120,637,272 - 120,639,516 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	10	119,485,136 - 119,490,787 (-)	NCBI		T2T-CHM13v2.0

Prlhr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	19	60,454,079 - 60,457,907 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	19	60,455,170 - 60,456,742 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	19	60,465,641 - 60,468,933 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	19	60,466,732 - 60,468,304 (-)	Ensembl			mm10	GRCm38
MGSCv37	19	60,542,636 - 60,544,207 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	19	60,521,404 - 60,522,967 (-)	NCBI		MGSCv36	mm8
Celera	19	62,669,595 - 62,671,166 (-)	NCBI		Celera
Cytogenetic Map	19	D3	NCBI
cM Map	19	56.52	NCBI

Prlhr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955431	23,192,018 - 23,193,130 (-)	Ensembl
ChiLan1.0	NW_004955431	23,192,018 - 23,193,130 (-)	NCBI	ChiLan1.0	ChiLan1.0

PRLHR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	8	130,445,186 - 130,456,588 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	10	130,450,787 - 130,461,926 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	10	114,922,829 - 115,168,506 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	10	118,589,819 - 118,592,053 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	10	118,590,543 - 118,591,655 (-)	Ensembl			panPan2	panpan1.1

PRLHR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	28	28,950,300 - 28,956,140 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	28	28,954,469 - 28,955,581 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	28	29,097,625 - 29,099,209 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	28	29,484,495 - 29,486,071 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	28	29,484,543 - 29,485,655 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	28	29,042,666 - 29,044,242 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	28	29,056,498 - 29,061,577 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	28	29,255,022 - 29,256,598 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Prlhr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	17,378,820 - 17,384,205 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936486	8,180,436 - 8,181,548 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936486	8,177,111 - 8,181,663 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PRLHR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	128,614,131 - 128,619,457 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	14	128,617,352 - 128,619,419 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	140,132,093 - 140,134,255 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PRLHR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	9	111,399,821 - 111,402,946 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	72,660,323 - 72,667,180 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Prlhr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624737	28,094,507 - 28,095,941 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624737	28,093,837 - 28,099,377 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Prlhr
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	2	55,686,413 - 55,687,825 (+)	NCBI		Rrattus_CSIRO_v1

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	160
Count of miRNA genes:	126
Interacting mature miRNAs:	131
Transcripts:	ENSRNOT00000013170
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
634313	Niddm43	Non-insulin dependent diabetes mellitus QTL 43			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	208479811	269633915	Rat
1549910	Bw54	Body weight QTL 54		0.05	body mass (VT:0001259)	body weight (CMO:0000012)	1	263946994	269633915	Rat
70211	Niddm24	Non-insulin dependent diabetes mellitus QTL 24	3.79		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	224633915	269633915	Rat
724552	Glom2	Glomerulus QTL 2	3.3	0.0001	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	1	232312773	270518180	Rat
61327	Eae7	Experimental allergic encephalomyelitis QTL 7	5.6		body mass (VT:0001259)	change in body weight (CMO:0002045)	1	226175591	270518180	Rat
1578775	Iddm21	Insulin dependent diabetes mellitus QTL 21	4.13		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	245782829	270518180	Rat
631837	Niddm35	Non-insulin dependent diabetes mellitus QTL 35		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	1	248619887	269633915	Rat
1600397	Edcs4	Endometrial carcinoma susceptibility QTL 4	2.2		uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	1	176288899	270518180	Rat
631836	Stl31	Serum triglyceride level QTL 31	4.64	5e-06	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	1	247133834	270518180	Rat
1549837	Hcar15	Hepatocarcinoma resistance QTL 15		0.05	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	162548015	270518180	Rat
1600390	Niddm64	Non-insulin dependent diabetes mellitus QTL 64		0.003	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	257624997	270518180	Rat
1300108	Rf8	Renal function QTL 8	3.75		renal blood flow trait (VT:2000006)	absolute change in renal vascular resistance (CMO:0001900)	1	237995023	269633915	Rat
734767	Niddm57	Non-insulin dependent diabetes mellitus QTL 57			body mass (VT:0001259)	body weight (CMO:0000012)	1	233480549	270108840	Rat
631215	Stl8	Serum triglyceride level QTL 8	9.27	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	1	234540191	270518180	Rat
7387289	Uae45	Urinary albumin excretion QTL 45	2.86	0.0021	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	233204160	270518180	Rat
631843	Bw116	Body weight QTL 116	4.1	0.016	abdominal adipose amount (VT:1000220)	abdominal fat pad weight (CMO:0000088)	1	233480549	270108840	Rat
731175	Uae20	Urinary albumin excretion QTL 20	3.5	0.0018	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	207163993	269633915	Rat
1598839	Rf56	Renal function QTL 56			renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	255849111	270518180	Rat
1581544	Rf52	Renal function QTL 52		0.05	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	1	241569529	269633915	Rat
631536	Lnnr2	Liver neoplastic nodule remodeling QTL 2	2.9	0.0005	liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number to liver total tumorous lesion number ratio (CMO:0001705)	1	243953669	270518180	Rat
734769	Niddm58	Non-insulin dependent diabetes mellitus QTL 58			body mass (VT:0001259)	body weight (CMO:0000012)	1	225108840	270108840	Rat
738032	Hcas5	Hepatocarcinoma susceptibility QTL 5	3.12		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	185857683	270518180	Rat
2302040	Pia35	Pristane induced arthritis QTL 35	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	226175591	270518180	Rat
631669	Iddm9	Insulin dependent diabetes mellitus QTL 9	2.8	0.039	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	1	233349180	270518180	Rat
737975	Bw122	Body weight QTL 122	9.11	0.005	body mass (VT:0001259)	body weight (CMO:0000012)	1	269158828	270108840	Rat
1598821	Rf55	Renal function QTL 55	6.3		renal blood flow trait (VT:2000006)	ratio of change in renal blood flow to change in renal perfusion pressure (CMO:0001239)	1	228174566	270518180	Rat

Markers in Region

D1Bda66

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	259,606,801 - 259,606,940 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	281,754,570 - 281,754,708	NCBI	Rnor6.0
Rnor_5.0	1	289,097,414 - 289,097,552	UniSTS	Rnor5.0
RGSC_v3.4	1	267,068,478 - 267,068,616	UniSTS	RGSC3.4
Celera	1	255,251,298 - 255,251,436	UniSTS
Cytogenetic Map	1	q55	UniSTS

Related Rat Strains

The following Strains have been annotated to Prlhr

BN.OLETF-(D1Rat169-D1Rat90)/Got

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
3	1	4	138	39	30	19	31	19	4	86	55	7	121	9	36	11	9	9

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_139193	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S77867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013170 ⟹ ENSRNOP00000013170

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	269,593,050 - 269,594,182 (-)	Ensembl
mRatBN7.2 Ensembl	1	259,606,704 - 259,608,391 (-)	Ensembl
Rnor_6.0 Ensembl	1	281,754,724 - 281,756,159 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000124456 ⟹ ENSRNOP00000108061

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	269,589,635 - 269,594,828 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000165422 ⟹ ENSRNOP00000109587

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	269,589,675 - 269,594,909 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000172893 ⟹ ENSRNOP00000098771

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	1	269,585,611 - 269,594,705 (-)	Ensembl

RefSeq Acc Id:

NM_139193 ⟹ NP_631932

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	269,592,735 - 269,594,422 (-)	NCBI
mRatBN7.2	1	259,606,704 - 259,608,391 (-)	NCBI
Rnor_6.0	1	281,754,472 - 281,756,159 (-)	NCBI
Rnor_5.0	1	289,097,316 - 289,099,003 (-)	NCBI
RGSC_v3.4	1	267,068,380 - 267,070,067 (-)	RGD
Celera	1	255,251,200 - 255,252,887 (-)	RGD

Sequence:

show sequence

AAGCTTGTTCACAGGTGGCCATGACCTCACTGCCCCCTGGAACCACTGGGGACCCCGATTTGTT
TTCTGGGCCGTCGCCAGCCGGCTCCACTCCAGCCAACCAGAGTGCAGAGGCTTCAGAGAGCAAT
GTGTCTGCGACGGTTCCCAGAGCTGCAGCAGTCACGCCGTTCCAGAGCCTGCAACTAGTGCACC
AGCTGAAGGGACTGATCGTGATGCTGTACAGCATCGTGGTGGTCGTGGGTCTGGTGGGCAACTG
CCTTCTTGTGCTGGTGATCGCGCGCGTGCGCCGGCTGCACAACGTGACCAACTTCCTCATCGGC
AACCTGGCCTTGTCCGATGTGCTCATGTGTGCCGCCTGTGTGCCTCTCACGCTGGCCTACGCCT
TTGAACCTCGTGGCTGGGTGTTCGGTGGAGGCCTGTGCCACCTTGTTTTCTTCCTGCAGCCGGT
CACCGTCTACGTATCGGTGTTCACACTCACCACAATCGCTGTGGACCGCTATGTGGTTCTGGTG
CACCCGCTACGTCGGCGCATTTCACTGAAGCTCAGCGCCTACGCTGTGCTGGGCATCTGGGCTC
TATCTGCAGTGCTGGCGCTGCCGGCCGCGGTGCACACCTACCATGTAGAGCTCAAGCCCCACGA
CGTGCGCCTCTGCGAGGAGTTCTGGGGTTCGCAGGAGCGCCAGAGACAGATCTATGCCTGGGGG
CTGCTGCTGGGCACCTATTTGCTCCCCCTGCTGGCCATTCTCCTGTCTTACGTCCGGGTGTCGG
TGAAGTTGCGGAACCGCGTGGTGCCTGGCAGCGTGACCCAGAGCCAGGCTGACTGGGACCGAGC
GCGTCGCCGTCGCACTTTCTGCCTGCTGGTGGTGGTGGTGGTCGTGTTCGCGCTCTGCTGGCTG
CCTCTGCACATTTTCAACCTTCTGCGGGACCTGGACCCGCGTGCCATCGACCCCTACGCCTTCG
GGCTGGTGCAGCTCCTCTGCCACTGGCTTGCCATGAGCTCCGCCTGCTACAACCCCTTCATCTA
TGCGTGGCTGCACGACAGCTTCCGAGAGGAGCTACGCAAGATGCTTCTGTCTTGGCCCCGCAAG
ATCGTGCCTCATGGCCAGAATATGACCGTCAGTGTGGTCATCTGATGACACTCTGCCAGGTCTG
AGCTGGGGAGCTTCAGAGTCATTAGCCCCGGAAGTCATCATGAGATCTTATTCCCATTTGCCAA
CACAAGTGAAATTCCTACCCAGCCCTCTAGACTAGCTATATGTCTGTTTGTGTGCTTGTGTGAA
ATGTTAGATAGGCTTTGGAGTAGAAGAGCCTGAGGAGAGAGAAGCAGATTTATCAGGTCTACCC
CTGAAAGCAAAAGAGATATTTTTCTGGGTTCAGAAAAAATAAATCAGAAGCAGTCTTTCTTTCC
TTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTNNCTTTCTTTCT

hide sequence

Protein Sequences


Protein RefSeqs	NP_631932	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB34129	(Get FASTA)	NCBI Sequence Viewer
	EDL94576	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000109587
GenBank Protein	Q64121	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_631932 ⟸ NM_139193

- UniProtKB:

Q64121 (UniProtKB/Swiss-Prot), G3V791 (UniProtKB/TrEMBL), A6JIA2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MTSLPPGTTGDPDLFSGPSPAGSTPANQSAEASESNVSATVPRAAAVTPFQSLQLVHQLKGLIV
MLYSIVVVVGLVGNCLLVLVIARVRRLHNVTNFLIGNLALSDVLMCAACVPLTLAYAFEPRGWV
FGGGLCHLVFFLQPVTVYVSVFTLTTIAVDRYVVLVHPLRRRISLKLSAYAVLGIWALSAVLAL
PAAVHTYHVELKPHDVRLCEEFWGSQERQRQIYAWGLLLGTYLLPLLAILLSYVRVSVKLRNRV
VPGSVTQSQADWDRARRRRTFCLLVVVVVVFALCWLPLHIFNLLRDLDPRAIDPYAFGLVQLLC
HWLAMSSACYNPFIYAWLHDSFREELRKMLLSWPRKIVPHGQNMTVSVVI

hide sequence

Ensembl Acc Id:

ENSRNOP00000013170 ⟸ ENSRNOT00000013170

Ensembl Acc Id:

ENSRNOP00000108061 ⟸ ENSRNOT00000124456

Ensembl Acc Id:

ENSRNOP00000109587 ⟸ ENSRNOT00000165422

Ensembl Acc Id:

ENSRNOP00000098771 ⟸ ENSRNOT00000172893

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64121-F1-model_v2	AlphaFold	Q64121	1-370	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:71037	AgrOrtholog
BioCyc Gene	G2FUF-55231	BioCyc
Ensembl Genes	ENSRNOG00000009922	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000165422	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Prolrel_pep_rcpt	UniProtKB/Swiss-Prot
KEGG Report	rno:246075	UniProtKB/Swiss-Prot
NCBI Gene	246075	ENTREZGENE
PANTHER	NEUROPEPTIDE Y RECEPTOR	UniProtKB/Swiss-Prot
	PTHR24235:SF11	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PhenoGen	Prlhr	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot
	PRPRECEPTOR	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009922	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	A6JIA2	ENTREZGENE, UniProtKB/TrEMBL
	G3V791	ENTREZGENE, UniProtKB/TrEMBL
	PRLHR_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Prlhr	prolactin releasing hormone receptor	Gpr10	G protein-coupled receptor 10	Symbol and Name updated	1299863	APPROVED
2002-07-09	Gpr10	G protein-coupled receptor 10			Symbol and Name updated to reflect Human and Mouse nomenclature	70877	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in pituitary, cerebellum, and hypothalamus	70750

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations

Mammalian Phenotype