Symbol:
Dusp6
Name:
dual specificity phosphatase 6
RGD ID:
70978
Description:
Enables protein tyrosine/serine/threonine phosphatase activity. Involved in several processes, including negative regulation of ERK1 and ERK2 cascade; response to growth factor; and response to xenobiotic stimulus. Predicted to be located in nucleoplasm. Predicted to be active in cytosol. Biomarker of brain ischemia and pancreatitis. Human ortholog(s) of this gene implicated in hypogonadotropic hypogonadism 19 with or without anosmia. Orthologous to human DUSP6 (dual specificity phosphatase 6); PARTICIPATES IN the extracellular signal-regulated Raf/Mek/Erk signaling pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH 1,3-dinitrobenzene; 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
dual specificity protein phosphatase 6; MAP kinase phosphatase 3; MGC93276; mitogen-activated protein kinase phosphatase 3; MKP-3; Mkp3
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 35,979,502 - 35,983,834 (+) NCBI GRCr8 mRatBN7.2 7 34,092,848 - 34,097,186 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 34,092,943 - 34,097,185 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 36,079,912 - 36,084,149 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 38,261,675 - 38,265,912 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 37,995,062 - 37,999,297 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 41,475,163 - 41,479,393 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 41,475,163 - 41,479,392 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 41,506,397 - 41,510,627 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 36,893,264 - 36,897,494 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 36,913,534 - 36,917,764 (+) NCBI Celera 7 31,106,671 - 31,110,901 (+) NCBI Celera Cytogenetic Map 7 q13 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dusp6 Rat (-)-alpha-phellandrene increases expression ISO DUSP6 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of DUSP6 mRNA CTD PMID:25075043 Dusp6 Rat (-)-anisomycin decreases expression ISO DUSP6 (Homo sapiens) 6480464 Anisomycin results in decreased expression of DUSP6 mRNA CTD PMID:24247028 Dusp6 Rat (-)-demecolcine increases expression ISO DUSP6 (Homo sapiens) 6480464 Demecolcine results in increased expression of DUSP6 mRNA CTD PMID:23649840 Dusp6 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of DUSP6 mRNA CTD PMID:22079256 Dusp6 Rat (S)-nicotine increases expression ISO Dusp6 (Mus musculus) 6480464 Nicotine results in increased expression of DUSP6 mRNA CTD PMID:17456735 and PMID:21955143 Dusp6 Rat 1,2-dimethylhydrazine multiple interactions ISO Dusp6 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DUSP6 mRNA CTD PMID:22206623 Dusp6 Rat 1,3-dinitrobenzene increases expression EXP 6480464 3-dinitrobenzene results in increased expression of DUSP6 mRNA CTD PMID:21983209 Dusp6 Rat 1-naphthyl isothiocyanate decreases expression EXP 6480464 1-Naphthylisothiocyanate results in decreased expression of DUSP6 mRNA CTD PMID:25380136 and PMID:30723492 Dusp6 Rat 1-nitropyrene increases expression ISO DUSP6 (Homo sapiens) 6480464 1-nitropyrene results in increased expression of DUSP6 mRNA CTD PMID:19041380 Dusp6 Rat 17alpha-ethynylestradiol affects expression EXP 6480464 Ethinyl Estradiol affects the expression of DUSP6 mRNA CTD PMID:16079270 Dusp6 Rat 17beta-estradiol multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of DUSP6 mRNA more ... CTD PMID:19619570 more ... Dusp6 Rat 17beta-estradiol decreases expression ISO Dusp6 (Mus musculus) 6480464 Estradiol results in decreased expression of DUSP6 mRNA CTD PMID:39298647 Dusp6 Rat 17beta-estradiol increases expression EXP 6480464 Estradiol results in increased expression of DUSP6 mRNA CTD PMID:32145629 Dusp6 Rat 17beta-estradiol increases expression ISO DUSP6 (Homo sapiens) 6480464 Estradiol results in increased expression of DUSP6 mRNA CTD PMID:19619570 more ... Dusp6 Rat 2,2',4,4',5,5'-hexachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Dusp6 Rat 2,2',4,4',5,5'-hexachlorobiphenyl increases expression ISO DUSP6 (Homo sapiens) 6480464 2 more ... CTD PMID:38568856 Dusp6 Rat 2,3,7,8-tetrachlorodibenzodioxine multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Estradiol co-treated with Tetrachlorodibenzodioxin] results in decreased expression of DUSP6 mRNA CTD PMID:19619570 Dusp6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of DUSP6 mRNA CTD PMID:34747641 Dusp6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DUSP6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DUSP6 mRNA CTD PMID:19619570 more ... Dusp6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Dusp6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of DUSP6 mRNA CTD PMID:21570461 Dusp6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO DUSP6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DUSP6 mRNA CTD PMID:20106945 and PMID:21632981 Dusp6 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DUSP6 mRNA CTD PMID:21215274 and PMID:33387578 Dusp6 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO DUSP6 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin affects the expression of DUSP6 mRNA CTD PMID:22298810 Dusp6 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO Dusp6 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in increased expression of DUSP6 mRNA CTD PMID:15328365 and PMID:19684285 Dusp6 Rat 2,4-diaminotoluene increases expression ISO Dusp6 (Mus musculus) 6480464 2 and 4-diaminotoluene results in increased expression of DUSP6 mRNA CTD PMID:20713471 Dusp6 Rat 2-butoxyethanol decreases expression ISO Dusp6 (Mus musculus) 6480464 n-butoxyethanol results in decreased expression of DUSP6 mRNA CTD PMID:19812364 Dusp6 Rat 2-hydroxypropanoic acid decreases expression ISO DUSP6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of DUSP6 mRNA CTD PMID:30851411 Dusp6 Rat 2-methylcholine affects expression ISO DUSP6 (Homo sapiens) 6480464 beta-methylcholine affects the expression of DUSP6 mRNA CTD PMID:21179406 Dusp6 Rat 2-nitrofluorene decreases expression EXP 6480464 2-nitrofluorene results in decreased expression of DUSP6 mRNA CTD PMID:15890375 Dusp6 Rat 2-palmitoylglycerol increases expression ISO DUSP6 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of DUSP6 mRNA CTD PMID:37199045 Dusp6 Rat 3,3',4,4',5-pentachlorobiphenyl multiple interactions EXP 6480464 [3 more ... CTD PMID:16984957 Dusp6 Rat 3,3',4,4',5-pentachlorobiphenyl increases expression EXP 6480464 3 more ... CTD PMID:23196670 Dusp6 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO DUSP6 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of DUSP6 mRNA CTD PMID:33476716 Dusp6 Rat 3,4-methylenedioxymethamphetamine increases expression ISO Dusp6 (Mus musculus) 6480464 N-Methyl-3 and 4-methylenedioxyamphetamine results in increased expression of DUSP6 mRNA CTD PMID:19285098 Dusp6 Rat 3-chloropropane-1,2-diol decreases expression EXP 6480464 alpha-Chlorohydrin results in decreased expression of DUSP6 mRNA CTD PMID:28522335 Dusp6 Rat 3-isobutyl-1-methyl-7H-xanthine multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of DUSP6 mRNA CTD PMID:28628672 Dusp6 Rat 3-methylcholanthrene increases expression ISO Dusp6 (Mus musculus) 6480464 Methylcholanthrene results in increased expression of DUSP6 mRNA CTD PMID:20713471 Dusp6 Rat 3-phenylprop-2-enal decreases expression ISO DUSP6 (Homo sapiens) 6480464 cinnamaldehyde results in decreased expression of DUSP6 mRNA CTD PMID:17178418 Dusp6 Rat 4,4'-diaminodiphenylmethane decreases expression EXP 6480464 4 and 4'-diaminodiphenylmethane results in decreased expression of DUSP6 mRNA CTD PMID:25380136 Dusp6 Rat 4,4'-sulfonyldiphenol increases expression ISO Dusp6 (Mus musculus) 6480464 bisphenol S results in increased expression of DUSP6 mRNA CTD PMID:30951980 and PMID:39298647 Dusp6 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one decreases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in decreased expression of DUSP6 mRNA CTD PMID:15890375 Dusp6 Rat 4-hydroxyphenyl retinamide increases expression ISO Dusp6 (Mus musculus) 6480464 Fenretinide results in increased expression of DUSP6 mRNA CTD PMID:28973697 Dusp6 Rat 5-aza-2'-deoxycytidine affects expression ISO DUSP6 (Homo sapiens) 6480464 Decitabine affects the expression of DUSP6 mRNA CTD PMID:17145863 Dusp6 Rat 5-aza-2'-deoxycytidine increases expression ISO DUSP6 (Homo sapiens) 6480464 Decitabine results in increased expression of DUSP6 mRNA and Decitabine results in increased expression of MKP3 mRNA CTD PMID:17785578 and PMID:19151715 Dusp6 Rat 5-azacytidine increases expression ISO DUSP6 (Homo sapiens) 6480464 Azacitidine results in increased expression of DUSP6 mRNA CTD PMID:21245298 Dusp6 Rat 5-bromo-2'-deoxyuridine multiple interactions ISO Dusp6 (Mus musculus) 6480464 [Bromodeoxyuridine co-treated with furan] results in increased expression of DUSP6 mRNA CTD PMID:24910943 Dusp6 Rat 5-fluorouracil increases expression ISO DUSP6 (Homo sapiens) 6480464 Fluorouracil results in increased expression of DUSP6 mRNA CTD PMID:16510598 Dusp6 Rat 6-propyl-2-thiouracil affects expression EXP 6480464 Propylthiouracil affects the expression of DUSP6 mRNA CTD PMID:25825206 Dusp6 Rat 6-propyl-2-thiouracil increases expression EXP 6480464 Propylthiouracil results in increased expression of DUSP6 mRNA CTD PMID:30047161 Dusp6 Rat 8-Br-cAMP decreases expression ISO DUSP6 (Homo sapiens) 6480464 8-Bromo Cyclic Adenosine Monophosphate results in decreased expression of DUSP6 mRNA CTD PMID:22079614 Dusp6 Rat acetylsalicylic acid increases expression EXP 6480464 Aspirin results in increased expression of DUSP6 mRNA CTD PMID:12800193 Dusp6 Rat acrylamide decreases expression EXP 6480464 Acrylamide results in decreased expression of DUSP6 mRNA CTD PMID:28959563 Dusp6 Rat ADP multiple interactions ISO DUSP6 (Homo sapiens) 6480464 Adenosine Diphosphate inhibits the reaction [Cesium-137 results in increased expression of DUSP6 protein] and Anthraquinones analog inhibits the reaction [Adenosine Diphosphate promotes the reaction [Cesium-137 results in decreased expression of DUSP6 protein]] CTD PMID:32941855 Dusp6 Rat aflatoxin B1 affects expression ISO DUSP6 (Homo sapiens) 6480464 Aflatoxin B1 affects the expression of DUSP6 protein CTD PMID:20106945 Dusp6 Rat aflatoxin B1 decreases methylation ISO DUSP6 (Homo sapiens) 6480464 Aflatoxin B1 results in decreased methylation of DUSP6 gene CTD PMID:27153756 Dusp6 Rat aflatoxin B1 increases expression ISO DUSP6 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of DUSP6 mRNA CTD PMID:21641981 and PMID:22100608 Dusp6 Rat aflatoxin B1 decreases expression EXP 6480464 Aflatoxin B1 results in decreased expression of DUSP6 mRNA CTD PMID:15890375 Dusp6 Rat aldehydo-D-glucose increases expression ISO Dusp6 (Mus musculus) 6480464 Glucose results in increased expression of DUSP6 mRNA CTD PMID:17178593 Dusp6 Rat alendronic acid affects expression EXP 6480464 Alendronate affects the expression of DUSP6 mRNA CTD PMID:16079270 Dusp6 Rat all-trans-retinoic acid increases expression ISO DUSP6 (Homo sapiens) 6480464 Tretinoin results in increased expression of DUSP6 mRNA CTD PMID:16012519 more ... Dusp6 Rat alpha-phellandrene increases expression ISO DUSP6 (Homo sapiens) 6480464 alpha phellandrene results in increased expression of DUSP6 mRNA CTD PMID:25075043 Dusp6 Rat amitrole decreases expression EXP 6480464 Amitrole results in decreased expression of DUSP6 mRNA CTD PMID:38685447 Dusp6 Rat amitrole increases expression EXP 6480464 Amitrole results in increased expression of DUSP6 mRNA CTD PMID:30047161 Dusp6 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of DUSP6 mRNA CTD PMID:16483693 Dusp6 Rat antirheumatic drug decreases expression ISO DUSP6 (Homo sapiens) 6480464 Antirheumatic Agents results in decreased expression of DUSP6 mRNA CTD PMID:24449571 Dusp6 Rat aripiprazole multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of DUSP6 mRNA CTD PMID:31476115 Dusp6 Rat aristolochic acid A increases expression ISO DUSP6 (Homo sapiens) 6480464 aristolochic acid I results in increased expression of DUSP6 mRNA CTD PMID:33212167 Dusp6 Rat arsenite(3-) increases expression ISO Dusp6 (Mus musculus) 6480464 arsenite results in increased expression of DUSP6 mRNA CTD PMID:33053406 Dusp6 Rat ATP multiple interactions ISO DUSP6 (Homo sapiens) 6480464 Adenosine Triphosphate inhibits the reaction [Cesium-137 results in increased expression of DUSP6 protein] and AZ10606120 inhibits the reaction [Adenosine Triphosphate promotes the reaction [Cesium-137 results in decreased expression of DUSP6 protein]] CTD PMID:32941855 Dusp6 Rat atrazine decreases expression ISO DUSP6 (Homo sapiens) 6480464 Atrazine results in decreased expression of DUSP6 mRNA CTD PMID:22378314 Dusp6 Rat Azaspiracid increases expression ISO DUSP6 (Homo sapiens) 6480464 azaspiracid results in increased expression of DUSP6 mRNA CTD PMID:28939011 Dusp6 Rat azoxystrobin multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of DUSP6 mRNA CTD PMID:33854195 Dusp6 Rat benzene-1,2,4-triol increases expression ISO DUSP6 (Homo sapiens) 6480464 hydroxyhydroquinone results in increased expression of DUSP6 mRNA CTD PMID:39245080 Dusp6 Rat benzo[a]pyrene increases expression ISO Dusp6 (Mus musculus) 6480464 Benzo(a)pyrene results in increased expression of DUSP6 mRNA CTD PMID:22228805 and PMID:32417428 Dusp6 Rat benzo[a]pyrene affects methylation ISO DUSP6 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of DUSP6 3' UTR CTD PMID:27901495 Dusp6 Rat benzo[a]pyrene increases expression ISO DUSP6 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of DUSP6 mRNA CTD PMID:20106945 more ... Dusp6 Rat benzo[a]pyrene diol epoxide I decreases expression ISO DUSP6 (Homo sapiens) 6480464 7 more ... CTD PMID:20018196 Dusp6 Rat benzo[a]pyrene diol epoxide I increases expression ISO DUSP6 (Homo sapiens) 6480464 7 more ... CTD PMID:26238291 Dusp6 Rat beta-naphthoflavone increases expression ISO DUSP6 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of DUSP6 mRNA CTD PMID:19737606 Dusp6 Rat bis(2-ethylhexyl) phthalate affects expression ISO Dusp6 (Mus musculus) 6480464 Diethylhexyl Phthalate affects the expression of DUSP6 mRNA CTD PMID:19850644 Dusp6 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DUSP6 mRNA CTD PMID:25181051 and PMID:35192832 Dusp6 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DUSP6 mRNA CTD PMID:32145629 Dusp6 Rat bisphenol A increases expression ISO Dusp6 (Mus musculus) 6480464 bisphenol A results in increased expression of DUSP6 mRNA CTD PMID:30951980 Dusp6 Rat bisphenol A increases expression ISO DUSP6 (Homo sapiens) 6480464 bisphenol A results in increased expression of DUSP6 mRNA CTD PMID:27685785 and PMID:33476716 Dusp6 Rat bisphenol A decreases expression ISO Dusp6 (Mus musculus) 6480464 bisphenol A results in decreased expression of DUSP6 mRNA CTD PMID:25594700 and PMID:33221593 Dusp6 Rat bisphenol F increases expression ISO Dusp6 (Mus musculus) 6480464 bisphenol F results in increased expression of DUSP6 mRNA CTD PMID:30951980 Dusp6 Rat bromobenzene decreases expression EXP 6480464 bromobenzene results in decreased expression of DUSP6 mRNA CTD PMID:32479839 Dusp6 Rat butanal increases expression ISO DUSP6 (Homo sapiens) 6480464 butyraldehyde results in increased expression of DUSP6 mRNA CTD PMID:26079696 Dusp6 Rat C.I. Natural Red 20 multiple interactions ISO Dusp6 (Mus musculus) 6480464 shikonin inhibits the reaction [Calcimycin results in increased expression of DUSP6 mRNA] CTD PMID:25451590 Dusp6 Rat cadmium atom increases expression ISO DUSP6 (Homo sapiens) 6480464 Cadmium results in increased expression of DUSP6 mRNA CTD PMID:22562489 Dusp6 Rat cadmium atom multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DUSP6 mRNA CTD PMID:35301059 Dusp6 Rat cadmium dichloride increases expression EXP 6480464 Cadmium Chloride results in increased expression of DUSP6 mRNA CTD PMID:25993096 Dusp6 Rat cadmium dichloride multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Cadmium Chloride results in increased abundance of Cadmium] which results in increased expression of DUSP6 mRNA CTD PMID:35301059 Dusp6 Rat cadmium dichloride decreases expression ISO DUSP6 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of DUSP6 mRNA CTD PMID:38568856 Dusp6 Rat cadmium dichloride increases expression ISO DUSP6 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of DUSP6 mRNA CTD PMID:38382870 Dusp6 Rat Calcimycin increases expression ISO Dusp6 (Mus musculus) 6480464 Calcimycin results in increased expression of DUSP6 mRNA CTD PMID:25451590 Dusp6 Rat Calcimycin multiple interactions ISO Dusp6 (Mus musculus) 6480464 shikonin inhibits the reaction [Calcimycin results in increased expression of DUSP6 mRNA] CTD PMID:25451590 Dusp6 Rat calciol decreases expression ISO Dusp6 (Mus musculus) 6480464 Cholecalciferol results in decreased expression of DUSP6 mRNA CTD PMID:16508948 Dusp6 Rat calciol increases expression ISO Dusp6 (Mus musculus) 6480464 Cholecalciferol results in increased expression of DUSP6 mRNA CTD PMID:17170073 Dusp6 Rat cannabidiol multiple interactions ISO Dusp6 (Mus musculus) 6480464 [Cannabidiol co-treated with MOG protein modified form] results in increased expression of DUSP6 mRNA and Cannabidiol promotes the reaction [MOG protein modified form results in increased expression of DUSP6 mRNA] CTD PMID:27256343 Dusp6 Rat cannabidiol increases expression ISO DUSP6 (Homo sapiens) 6480464 Cannabidiol results in increased expression of DUSP6 mRNA CTD PMID:33244087 Dusp6 Rat captan increases expression ISO Dusp6 (Mus musculus) 6480464 Captan results in increased expression of DUSP6 mRNA CTD PMID:31558096 Dusp6 Rat carbon nanotube decreases expression ISO Dusp6 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25620056 Dusp6 Rat carbon nanotube increases expression ISO Dusp6 (Mus musculus) 6480464 Nanotubes more ... CTD PMID:25554681 Dusp6 Rat casticin decreases expression ISO Dusp6 (Mus musculus) 6480464 casticin results in decreased expression of DUSP6 mRNA CTD PMID:28444820 Dusp6 Rat cefaloridine affects expression EXP 6480464 Cephaloridine affects the expression of DUSP6 mRNA CTD PMID:18172885 Dusp6 Rat ceruletide increases expression EXP 6480464 Ceruletide results in increased expression of DUSP6 mRNA CTD PMID:11027531 Dusp6 Rat chlorpyrifos multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of DUSP6 mRNA CTD PMID:33854195 Dusp6 Rat chromium(6+) increases expression ISO DUSP6 (Homo sapiens) 6480464 chromium hexavalent ion results in increased expression of DUSP6 mRNA CTD PMID:27793765 Dusp6 Rat chromium(6+) multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [zinc chromate results in increased abundance of chromium hexavalent ion] which results in increased expression of DUSP6 mRNA CTD PMID:38479592 Dusp6 Rat ciguatoxin CTX1B affects expression ISO Dusp6 (Mus musculus) 6480464 Ciguatoxins affects the expression of DUSP6 mRNA CTD PMID:18353800 Dusp6 Rat cisplatin decreases expression ISO DUSP6 (Homo sapiens) 6480464 Cisplatin results in decreased expression of DUSP6 protein CTD PMID:21996734 Dusp6 Rat cisplatin increases response to substance ISO DUSP6 (Homo sapiens) 6480464 DUSP6 results in increased susceptibility to Cisplatin CTD PMID:21996734 Dusp6 Rat cisplatin decreases expression EXP 6480464 Cisplatin results in decreased expression of DUSP6 mRNA CTD PMID:18172885 Dusp6 Rat cisplatin decreases response to substance ISO DUSP6 (Homo sapiens) 6480464 DUSP6 protein results in decreased susceptibility to Cisplatin CTD PMID:21499306 Dusp6 Rat cisplatin multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Cisplatin co-treated with jinfukang] results in decreased expression of DUSP6 mRNA more ... CTD PMID:21996734 and PMID:27392435 Dusp6 Rat clobetasol increases expression ISO Dusp6 (Mus musculus) 6480464 Clobetasol results in increased expression of DUSP6 mRNA CTD PMID:27462272 Dusp6 Rat clofibrate multiple interactions ISO Dusp6 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of DUSP6 mRNA and PPARA affects the reaction [[Clofibrate co-treated with Acetaminophen] affects the expression of DUSP6 mRNA] CTD PMID:17585979 Dusp6 Rat clozapine decreases expression EXP 6480464 Clozapine results in decreased expression of DUSP6 mRNA CTD PMID:15860345 Dusp6 Rat cobalt dichloride decreases expression ISO Dusp6 (Mus musculus) 6480464 cobaltous chloride results in decreased expression of DUSP6 mRNA CTD PMID:21139344 Dusp6 Rat cobalt dichloride increases expression ISO DUSP6 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of DUSP6 mRNA CTD PMID:19376846 Dusp6 Rat copper atom increases expression EXP 6480464 Copper results in increased expression of DUSP6 mRNA CTD PMID:22465980 Dusp6 Rat copper atom multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of DUSP6 mRNA CTD PMID:30911355 Dusp6 Rat copper atom multiple interactions ISO Dusp6 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of DUSP6 mRNA CTD PMID:15467011 Dusp6 Rat copper(0) increases expression EXP 6480464 Copper results in increased expression of DUSP6 mRNA CTD PMID:22465980 Dusp6 Rat copper(0) multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Chelating Agents binds to Copper] which results in increased expression of DUSP6 mRNA CTD PMID:30911355 Dusp6 Rat copper(0) multiple interactions ISO Dusp6 (Mus musculus) 6480464 [ATP7A gene mutant form results in increased abundance of Copper] which results in decreased expression of DUSP6 mRNA CTD PMID:15467011 Dusp6 Rat copper(II) chloride increases expression ISO DUSP6 (Homo sapiens) 6480464 cupric chloride results in increased expression of DUSP6 mRNA CTD PMID:38568856 Dusp6 Rat copper(II) sulfate increases expression ISO DUSP6 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of DUSP6 mRNA CTD PMID:19549813 Dusp6 Rat crocidolite asbestos multiple interactions ISO DUSP6 (Homo sapiens) 6480464 MAPK14 protein promotes the reaction [Asbestos more ... CTD PMID:18314537 Dusp6 Rat crocidolite asbestos affects expression ISO DUSP6 (Homo sapiens) 6480464 Asbestos and Crocidolite affects the expression of DUSP6 mRNA CTD PMID:17331233 and PMID:25757056 Dusp6 Rat crocidolite asbestos increases expression ISO DUSP6 (Homo sapiens) 6480464 Asbestos more ... CTD PMID:18314537 more ... Dusp6 Rat Cuprizon decreases expression EXP 6480464 Cuprizone results in decreased expression of DUSP6 mRNA CTD PMID:26577399 Dusp6 Rat cyclosporin A increases expression ISO DUSP6 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DUSP6 mRNA CTD PMID:20106945 Dusp6 Rat cyclosporin A decreases expression ISO DUSP6 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DUSP6 mRNA CTD PMID:25562108 Dusp6 Rat D-glucose increases expression ISO Dusp6 (Mus musculus) 6480464 Glucose results in increased expression of DUSP6 mRNA CTD PMID:17178593 Dusp6 Rat D-penicillamine increases expression EXP 6480464 Penicillamine results in increased expression of DUSP6 mRNA CTD PMID:19575532 Dusp6 Rat deoxynivalenol decreases expression ISO DUSP6 (Homo sapiens) 6480464 deoxynivalenol results in decreased expression of DUSP6 mRNA CTD PMID:24247028 Dusp6 Rat dexamethasone multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of DUSP6 mRNA CTD PMID:28628672 Dusp6 Rat dibutyl phthalate increases expression ISO Dusp6 (Mus musculus) 6480464 Dibutyl Phthalate results in increased expression of DUSP6 mRNA CTD PMID:17361019 and PMID:21266533 Dusp6 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of DUSP6 mRNA CTD PMID:21266533 and PMID:21745491 Dusp6 Rat dichloroacetic acid increases expression ISO Dusp6 (Mus musculus) 6480464 Dichloroacetic Acid results in increased expression of DUSP6 mRNA CTD PMID:28962523 Dusp6 Rat diethyl maleate increases expression ISO DUSP6 (Homo sapiens) 6480464 diethyl maleate results in increased expression of DUSP6 mRNA CTD PMID:33545341 Dusp6 Rat diethylstilbestrol decreases expression EXP 6480464 Diethylstilbestrol results in decreased expression of DUSP6 mRNA CTD PMID:15890375 Dusp6 Rat diethylstilbestrol decreases expression ISO Dusp6 (Mus musculus) 6480464 Diethylstilbestrol results in decreased expression of DUSP6 mRNA CTD PMID:15171707 Dusp6 Rat dimethylarsinic acid multiple interactions ISO Dusp6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of DUSP6 mRNA CTD PMID:34876320 Dusp6 Rat dioxygen increases expression ISO DUSP6 (Homo sapiens) 6480464 Oxygen deficiency results in increased expression of DUSP6 mRNA CTD PMID:26516004 Dusp6 Rat dioxygen multiple interactions EXP 6480464 [Oxygen deficiency co-treated with Blood Glucose deficiency co-treated with Particulate Matter] results in increased expression of DUSP6 mRNA CTD PMID:33729688 Dusp6 Rat dioxygen multiple interactions ISO Dusp6 (Mus musculus) 6480464 [NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of DUSP6 mRNA CTD PMID:30529165 Dusp6 Rat diuron decreases expression ISO DUSP6 (Homo sapiens) 6480464 Diuron results in decreased expression of DUSP6 mRNA CTD PMID:35967413 Dusp6 Rat divanadium pentaoxide affects expression ISO DUSP6 (Homo sapiens) 6480464 vanadium pentoxide affects the expression of DUSP6 mRNA CTD PMID:17459161 Dusp6 Rat dizocilpine maleate multiple interactions EXP 6480464 Dizocilpine Maleate inhibits the reaction [Methamphetamine results in increased expression of DUSP6 mRNA] CTD PMID:11701771 Dusp6 Rat dorsomorphin multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP6 mRNA CTD PMID:27188386 Dusp6 Rat doxorubicin decreases expression ISO Dusp6 (Mus musculus) 6480464 Doxorubicin results in decreased expression of DUSP6 mRNA CTD PMID:21040762 Dusp6 Rat doxorubicin decreases expression ISO DUSP6 (Homo sapiens) 6480464 Doxorubicin results in decreased expression of DUSP6 mRNA CTD PMID:29803840 Dusp6 Rat doxorubicin increases expression ISO DUSP6 (Homo sapiens) 6480464 Doxorubicin results in increased expression of DUSP6 mRNA CTD PMID:30031762 Dusp6 Rat doxorubicin multiple interactions ISO Dusp6 (Mus musculus) 6480464 [[MT1 protein co-treated with MT2 protein] affects the susceptibility to Doxorubicin] which affects the expression of DUSP6 mRNA CTD PMID:21040762 Dusp6 Rat endosulfan increases expression EXP 6480464 Endosulfan results in increased expression of DUSP6 mRNA CTD PMID:29391264 Dusp6 Rat epoxiconazole increases expression ISO Dusp6 (Mus musculus) 6480464 epoxiconazole results in increased expression of DUSP6 mRNA CTD PMID:35436446 Dusp6 Rat ethanol decreases expression ISO Dusp6 (Mus musculus) 6480464 Ethanol results in decreased expression of DUSP6 mRNA CTD PMID:21955143 Dusp6 Rat ethanol multiple interactions ISO Dusp6 (Mus musculus) 6480464 Ethanol affects the expression of and affects the splicing of DUSP6 mRNA CTD PMID:30319688 Dusp6 Rat fentin chloride increases expression EXP 6480464 triphenyltin chloride results in increased expression of DUSP6 mRNA CTD PMID:37156404 Dusp6 Rat fluoranthene multiple interactions ISO Dusp6 (Mus musculus) 6480464 [1-methylanthracene co-treated with fluoranthene] results in increased expression of DUSP6 mRNA CTD PMID:28329830 Dusp6 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DUSP6 mRNA CTD PMID:24136188 Dusp6 Rat folic acid multiple interactions ISO Dusp6 (Mus musculus) 6480464 [1 and 2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of DUSP6 mRNA CTD PMID:22206623 Dusp6 Rat folpet increases expression ISO Dusp6 (Mus musculus) 6480464 folpet results in increased expression of DUSP6 mRNA CTD PMID:31558096 Dusp6 Rat fonofos increases methylation ISO DUSP6 (Homo sapiens) 6480464 Fonofos results in increased methylation of DUSP6 promoter CTD PMID:22847954 Dusp6 Rat formaldehyde increases expression ISO DUSP6 (Homo sapiens) 6480464 Formaldehyde results in increased expression of DUSP6 mRNA CTD PMID:23416264 and PMID:27664576 Dusp6 Rat furan multiple interactions ISO Dusp6 (Mus musculus) 6480464 [Bromodeoxyuridine co-treated with furan] results in increased expression of DUSP6 mRNA CTD PMID:24910943 Dusp6 Rat furan increases expression ISO Dusp6 (Mus musculus) 6480464 furan results in increased expression of DUSP6 mRNA CTD PMID:24183702 more ... Dusp6 Rat genistein increases expression ISO DUSP6 (Homo sapiens) 6480464 Genistein results in increased expression of DUSP6 mRNA CTD PMID:23019147 Dusp6 Rat genistein decreases expression ISO DUSP6 (Homo sapiens) 6480464 Genistein results in decreased expression of DUSP6 mRNA CTD PMID:22228119 Dusp6 Rat glucose increases expression ISO Dusp6 (Mus musculus) 6480464 Glucose results in increased expression of DUSP6 mRNA CTD PMID:17178593 Dusp6 Rat glyphosate multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of DUSP6 mRNA CTD PMID:33854195 Dusp6 Rat glyphosate increases expression EXP 6480464 Glyphosate results in increased expression of DUSP6 mRNA CTD PMID:34850229 Dusp6 Rat glyphosate decreases expression ISO DUSP6 (Homo sapiens) 6480464 Glyphosate results in decreased expression of DUSP6 mRNA CTD PMID:31295307 Dusp6 Rat haloperidol decreases expression EXP 6480464 Haloperidol results in decreased expression of DUSP6 mRNA CTD PMID:15860345 Dusp6 Rat hydrogen peroxide affects expression ISO DUSP6 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of DUSP6 mRNA CTD PMID:20044591 Dusp6 Rat hydroquinone increases expression ISO DUSP6 (Homo sapiens) 6480464 hydroquinone results in increased expression of DUSP6 mRNA CTD PMID:31256213 Dusp6 Rat imidacloprid multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of DUSP6 mRNA CTD PMID:33854195 Dusp6 Rat indometacin decreases expression ISO DUSP6 (Homo sapiens) 6480464 Indomethacin results in decreased expression of DUSP6 mRNA CTD PMID:16984733 Dusp6 Rat indometacin multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin] results in increased expression of DUSP6 mRNA CTD PMID:28628672 Dusp6 Rat irinotecan affects expression EXP 6480464 Irinotecan affects the expression of DUSP6 mRNA CTD PMID:20097248 Dusp6 Rat L-ascorbic acid decreases expression EXP 6480464 Ascorbic Acid results in decreased expression of DUSP6 mRNA CTD PMID:15372504 Dusp6 Rat leflunomide increases expression ISO DUSP6 (Homo sapiens) 6480464 leflunomide results in increased expression of DUSP6 mRNA CTD PMID:28988120 Dusp6 Rat lipopolysaccharide decreases expression ISO Dusp6 (Mus musculus) 6480464 Lipopolysaccharides results in decreased expression of DUSP6 mRNA CTD PMID:25890327 Dusp6 Rat manganese(II) chloride increases expression EXP 6480464 manganese chloride results in increased expression of DUSP6 mRNA CTD PMID:28801915 Dusp6 Rat manganese(II) chloride increases methylation EXP 6480464 manganese chloride results in increased methylation of DUSP6 gene CTD PMID:28801915 Dusp6 Rat menadione affects expression ISO DUSP6 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of DUSP6 mRNA CTD PMID:20044591 Dusp6 Rat metacetamol decreases expression ISO Dusp6 (Mus musculus) 6480464 3-hydroxyacetanilide results in decreased expression of DUSP6 mRNA CTD PMID:18544908 Dusp6 Rat methamphetamine multiple interactions EXP 6480464 [SCH 23390 binds to and results in decreased activity of DRD1 protein] inhibits the reaction [Methamphetamine results in increased expression of DUSP6 mRNA] and Dizocilpine Maleate inhibits the reaction [Methamphetamine results in increased expression of DUSP6 mRNA] CTD PMID:11701771 Dusp6 Rat methamphetamine increases expression EXP 6480464 Methamphetamine results in increased expression of DUSP6 mRNA CTD PMID:11701771 Dusp6 Rat methapyrilene decreases expression EXP 6480464 Methapyrilene results in decreased expression of DUSP6 mRNA CTD PMID:15890375 Dusp6 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of DUSP6 mRNA CTD PMID:30467583 Dusp6 Rat methimazole decreases expression EXP 6480464 Methimazole results in decreased expression of DUSP6 mRNA CTD PMID:38685447 Dusp6 Rat methimazole increases expression EXP 6480464 Methimazole results in increased expression of DUSP6 mRNA CTD PMID:30047161 Dusp6 Rat methylarsonic acid multiple interactions ISO Dusp6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of DUSP6 mRNA CTD PMID:34876320 Dusp6 Rat methylisothiazolinone increases expression ISO DUSP6 (Homo sapiens) 6480464 2-methyl-4-isothiazolin-3-one results in increased expression of DUSP6 mRNA CTD PMID:31629900 Dusp6 Rat methylmercury chloride increases expression ISO DUSP6 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of DUSP6 mRNA CTD PMID:28001369 Dusp6 Rat methylmercury(1+) increases expression EXP 6480464 methylmercury II results in increased expression of DUSP6 mRNA CTD PMID:17905399 Dusp6 Rat mono(2-ethylhexyl) phthalate increases expression EXP 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of DUSP6 mRNA CTD PMID:16809437 Dusp6 Rat mono(2-ethylhexyl) phthalate increases expression ISO DUSP6 (Homo sapiens) 6480464 mono-(2-ethylhexyl)phthalate results in increased expression of DUSP6 mRNA CTD PMID:36695872 Dusp6 Rat morphine increases expression ISO Dusp6 (Mus musculus) 6480464 Morphine deficiency results in increased expression of DUSP6 mRNA and Morphine results in increased expression of DUSP6 mRNA CTD PMID:21955143 and PMID:27126842 Dusp6 Rat Muraglitazar decreases expression EXP 6480464 muraglitazar results in decreased expression of DUSP6 mRNA CTD PMID:21515302 Dusp6 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of DUSP6 gene CTD PMID:33148267 Dusp6 Rat N-(6-acetamidohexyl)acetamide decreases expression ISO DUSP6 (Homo sapiens) 6480464 hexamethylene bisacetamide results in decreased expression of DUSP6 protein mutant form CTD PMID:17569113 Dusp6 Rat N-methyl-4-phenylpyridinium decreases expression ISO DUSP6 (Homo sapiens) 6480464 1-Methyl-4-phenylpyridinium results in decreased expression of DUSP6 mRNA CTD PMID:24810058 Dusp6 Rat N-methylformamide increases expression ISO Dusp6 (Mus musculus) 6480464 methylformamide analog results in increased expression of DUSP6 mRNA and methylformamide results in increased expression of DUSP6 mRNA CTD PMID:17040096 Dusp6 Rat N-nitrosodiethylamine multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of DUSP6 mRNA CTD PMID:20360939 Dusp6 Rat N-nitrosodiethylamine increases expression ISO Dusp6 (Mus musculus) 6480464 Diethylnitrosamine results in increased expression of DUSP6 mRNA CTD PMID:24535843 Dusp6 Rat N-nitrosodimethylamine decreases expression EXP 6480464 Dimethylnitrosamine results in decreased expression of DUSP6 mRNA CTD PMID:15890375 and PMID:25380136 Dusp6 Rat N-Nitrosopyrrolidine increases expression ISO DUSP6 (Homo sapiens) 6480464 N-Nitrosopyrrolidine results in increased expression of DUSP6 mRNA CTD PMID:32234424 Dusp6 Rat nickel dichloride increases expression ISO DUSP6 (Homo sapiens) 6480464 nickel chloride results in increased expression of DUSP6 mRNA CTD PMID:17312168 Dusp6 Rat nicotine increases expression ISO Dusp6 (Mus musculus) 6480464 Nicotine results in increased expression of DUSP6 mRNA CTD PMID:17456735 and PMID:21955143 Dusp6 Rat obeticholic acid increases expression ISO DUSP6 (Homo sapiens) 6480464 obeticholic acid results in increased expression of DUSP6 mRNA CTD PMID:27939613 Dusp6 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DUSP6 mRNA CTD PMID:25729387 Dusp6 Rat oxaliplatin increases expression EXP 6480464 oxaliplatin results in increased expression of DUSP6 mRNA CTD PMID:25729387 Dusp6 Rat ozone increases expression ISO DUSP6 (Homo sapiens) 6480464 Ozone results in increased expression of DUSP6 mRNA CTD PMID:31476115 Dusp6 Rat ozone multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Aripiprazole co-treated with Ozone] results in increased expression of DUSP6 mRNA CTD PMID:31476115 Dusp6 Rat paracetamol multiple interactions ISO Dusp6 (Mus musculus) 6480464 [Clofibrate co-treated with Acetaminophen] affects the expression of DUSP6 mRNA more ... CTD PMID:17585979 and PMID:29246445 Dusp6 Rat paracetamol increases expression ISO DUSP6 (Homo sapiens) 6480464 Acetaminophen results in increased expression of DUSP6 mRNA CTD PMID:29067470 Dusp6 Rat paracetamol affects expression ISO Dusp6 (Mus musculus) 6480464 Acetaminophen affects the expression of DUSP6 mRNA CTD PMID:17562736 Dusp6 Rat paracetamol increases expression ISO Dusp6 (Mus musculus) 6480464 Acetaminophen results in increased expression of DUSP6 mRNA CTD PMID:18544908 and PMID:29246445 Dusp6 Rat parathion increases methylation ISO DUSP6 (Homo sapiens) 6480464 Parathion results in increased methylation of DUSP6 promoter CTD PMID:22847954 Dusp6 Rat PD 0325901 multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [mirdametinib co-treated with (+)-JQ1 compound] results in decreased expression of DUSP6 mRNA CTD PMID:25119042 Dusp6 Rat PD 0325901 decreases expression ISO DUSP6 (Homo sapiens) 6480464 mirdametinib results in decreased expression of DUSP6 mRNA CTD PMID:25119042 Dusp6 Rat pentanal increases expression ISO DUSP6 (Homo sapiens) 6480464 pentanal results in increased expression of DUSP6 mRNA CTD PMID:26079696 Dusp6 Rat perfluorooctane-1-sulfonic acid decreases expression EXP 6480464 perfluorooctane sulfonic acid results in decreased expression of DUSP6 mRNA CTD PMID:19162173 Dusp6 Rat perfluorooctanoic acid decreases expression EXP 6480464 perfluorooctanoic acid results in decreased expression of DUSP6 mRNA CTD PMID:19162173 Dusp6 Rat permethrin increases expression EXP 6480464 Permethrin results in increased expression of DUSP6 mRNA CTD PMID:19017407 Dusp6 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of DUSP6 gene CTD PMID:33148267 Dusp6 Rat phenethyl caffeate multiple interactions EXP 6480464 [Diethylnitrosamine co-treated with caffeic acid phenethyl ester] results in increased expression of DUSP6 mRNA CTD PMID:20360939 Dusp6 Rat phenobarbital affects expression EXP 6480464 Phenobarbital affects the expression of DUSP6 mRNA CTD PMID:19162173 Dusp6 Rat phenobarbital increases expression EXP 6480464 Phenobarbital results in increased expression of DUSP6 mRNA CTD PMID:30047161 Dusp6 Rat phenobarbital affects expression ISO Dusp6 (Mus musculus) 6480464 Phenobarbital affects the expression of DUSP6 mRNA CTD PMID:23091169 Dusp6 Rat phenobarbital affects expression ISO DUSP6 (Homo sapiens) 6480464 Phenobarbital affects the expression of DUSP6 mRNA CTD PMID:19159669 Dusp6 Rat phenobarbital multiple interactions ISO Dusp6 (Mus musculus) 6480464 NR1I3 protein promotes the reaction [Phenobarbital results in increased expression of DUSP6 mRNA] CTD PMID:19850644 Dusp6 Rat phenobarbital increases expression ISO Dusp6 (Mus musculus) 6480464 Phenobarbital results in increased expression of DUSP6 mRNA CTD PMID:19850644 Dusp6 Rat phenylephrine multiple interactions EXP 6480464 DUSP6 protein inhibits the reaction [Phenylephrine results in increased phosphorylation of EIF4EBP1 protein] more ... CTD PMID:15757502 Dusp6 Rat phenylmercury acetate increases expression ISO DUSP6 (Homo sapiens) 6480464 Phenylmercuric Acetate results in increased expression of DUSP6 mRNA CTD PMID:26272509 Dusp6 Rat phenylmercury acetate multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP6 mRNA CTD PMID:27188386 Dusp6 Rat piperonyl butoxide decreases expression EXP 6480464 Piperonyl Butoxide results in decreased expression of DUSP6 mRNA CTD PMID:15890375 and PMID:22484513 Dusp6 Rat pirinixic acid multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [pirinixic acid binds to and results in increased activity of PPARA protein] which results in decreased expression of DUSP6 mRNA CTD PMID:19710929 Dusp6 Rat pirinixic acid multiple interactions ISO Dusp6 (Mus musculus) 6480464 PPARA protein promotes the reaction [pirinixic acid results in decreased expression of DUSP6 mRNA] CTD PMID:19850644 Dusp6 Rat pirinixic acid decreases expression EXP 6480464 pirinixic acid results in decreased expression of DUSP6 mRNA CTD PMID:15890375 and PMID:19162173 Dusp6 Rat pirinixic acid affects expression ISO Dusp6 (Mus musculus) 6480464 pirinixic acid affects the expression of DUSP6 mRNA CTD PMID:19850644 Dusp6 Rat pirinixic acid decreases expression ISO Dusp6 (Mus musculus) 6480464 pirinixic acid results in decreased expression of DUSP6 mRNA CTD PMID:17426115 Dusp6 Rat potassium chromate increases expression ISO DUSP6 (Homo sapiens) 6480464 potassium chromate(VI) results in increased expression of DUSP6 mRNA CTD PMID:22079256 Dusp6 Rat potassium chromate multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of DUSP6 mRNA CTD PMID:22079256 Dusp6 Rat pregnenolone 16alpha-carbonitrile affects expression EXP 6480464 Pregnenolone Carbonitrile affects the expression of DUSP6 mRNA CTD PMID:19162173 Dusp6 Rat progesterone increases expression ISO DUSP6 (Homo sapiens) 6480464 Progesterone results in increased expression of DUSP6 mRNA CTD PMID:18037150 Dusp6 Rat progesterone decreases expression ISO DUSP6 (Homo sapiens) 6480464 Progesterone results in decreased expression of DUSP6 mRNA CTD PMID:20864642 Dusp6 Rat progesterone multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in decreased expression of DUSP6 mRNA CTD PMID:20660070 Dusp6 Rat propanal increases expression ISO DUSP6 (Homo sapiens) 6480464 propionaldehyde results in increased expression of DUSP6 mRNA CTD PMID:26079696 Dusp6 Rat quercetin decreases expression ISO DUSP6 (Homo sapiens) 6480464 Quercetin results in decreased expression of DUSP6 mRNA CTD PMID:21632981 Dusp6 Rat rac-lactic acid decreases expression ISO DUSP6 (Homo sapiens) 6480464 Lactic Acid results in decreased expression of DUSP6 mRNA CTD PMID:30851411 Dusp6 Rat raloxifene affects expression EXP 6480464 Raloxifene Hydrochloride affects the expression of DUSP6 mRNA CTD PMID:16079270 Dusp6 Rat rotenone increases expression ISO DUSP6 (Homo sapiens) 6480464 Rotenone results in increased expression of DUSP6 mRNA CTD PMID:29955902 Dusp6 Rat SB 203580 multiple interactions ISO DUSP6 (Homo sapiens) 6480464 SB 203580 inhibits the reaction [Asbestos and Crocidolite results in increased expression of DUSP6 mRNA] CTD PMID:18314537 Dusp6 Rat SB 431542 multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression of DUSP6 mRNA CTD PMID:27188386 Dusp6 Rat SCH 23390 multiple interactions EXP 6480464 [SCH 23390 binds to and results in decreased activity of DRD1 protein] inhibits the reaction [Methamphetamine results in increased expression of DUSP6 mRNA] CTD PMID:11701771 Dusp6 Rat scopolamine decreases expression EXP 6480464 Scopolamine results in decreased expression of DUSP6 mRNA CTD PMID:17540011 Dusp6 Rat sevoflurane affects expression EXP 6480464 sevoflurane affects the expression of DUSP6 mRNA CTD PMID:15967596 Dusp6 Rat Shikonin multiple interactions ISO Dusp6 (Mus musculus) 6480464 shikonin inhibits the reaction [Calcimycin results in increased expression of DUSP6 mRNA] CTD PMID:25451590 Dusp6 Rat silicon dioxide increases expression ISO DUSP6 (Homo sapiens) 6480464 Silicon Dioxide results in increased expression of DUSP6 mRNA CTD PMID:25351596 Dusp6 Rat sodium arsenate multiple interactions ISO Dusp6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of DUSP6 mRNA CTD PMID:34876320 Dusp6 Rat sodium arsenite decreases expression ISO DUSP6 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DUSP6 mRNA CTD PMID:12377979 more ... Dusp6 Rat sodium arsenite multiple interactions ISO Dusp6 (Mus musculus) 6480464 [sodium arsenate co-treated with sodium arsenite co-treated with monomethylarsonic acid co-treated with Cacodylic Acid] results in decreased expression of DUSP6 mRNA CTD PMID:34876320 Dusp6 Rat sodium arsenite increases expression ISO DUSP6 (Homo sapiens) 6480464 sodium arsenite results in increased expression of DUSP6 mRNA CTD PMID:34032870 Dusp6 Rat sodium dichromate increases expression EXP 6480464 sodium bichromate results in increased expression of DUSP6 mRNA CTD PMID:22561333 Dusp6 Rat sotorasib multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DUSP6 mRNA CTD PMID:36139627 Dusp6 Rat succimer multiple interactions ISO Dusp6 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in increased expression of DUSP6 mRNA CTD PMID:21641980 Dusp6 Rat sulforaphane increases expression ISO DUSP6 (Homo sapiens) 6480464 sulforaphane results in increased expression of DUSP6 mRNA CTD PMID:31838189 Dusp6 Rat sunitinib increases expression ISO DUSP6 (Homo sapiens) 6480464 Sunitinib results in increased expression of DUSP6 mRNA CTD PMID:31533062 Dusp6 Rat tebufenpyrad increases expression ISO DUSP6 (Homo sapiens) 6480464 4-chloro-N-((4-(1 and 1-dimethylethyl)phenyl)methyl)-3-ethyl-1-methyl-1H-pyrazole-5-carboxamide results in increased expression of DUSP6 mRNA CTD PMID:33512557 Dusp6 Rat temozolomide increases expression ISO DUSP6 (Homo sapiens) 6480464 Temozolomide results in increased expression of DUSP6 mRNA CTD PMID:31758290 Dusp6 Rat terbufos increases methylation ISO DUSP6 (Homo sapiens) 6480464 terbufos results in increased methylation of DUSP6 promoter CTD PMID:22847954 Dusp6 Rat tert-butyl hydroperoxide decreases expression ISO DUSP6 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in decreased expression of DUSP6 mRNA CTD PMID:17003459 Dusp6 Rat tert-butyl hydroperoxide increases expression ISO DUSP6 (Homo sapiens) 6480464 tert-Butylhydroperoxide results in increased expression of DUSP6 mRNA CTD PMID:15336504 Dusp6 Rat Tesaglitazar decreases expression EXP 6480464 tesaglitazar results in decreased expression of DUSP6 mRNA CTD PMID:21515302 Dusp6 Rat testosterone decreases expression ISO Dusp6 (Mus musculus) 6480464 Testosterone results in decreased expression of DUSP6 mRNA CTD PMID:20600201 and PMID:21669218 Dusp6 Rat tetrachloromethane increases expression ISO Dusp6 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DUSP6 mRNA CTD PMID:27339419 and PMID:31919559 Dusp6 Rat thapsigargin increases expression ISO DUSP6 (Homo sapiens) 6480464 Thapsigargin results in increased expression of DUSP6 mRNA CTD PMID:24247028 Dusp6 Rat thapsigargin decreases expression ISO DUSP6 (Homo sapiens) 6480464 Thapsigargin results in decreased expression of DUSP6 mRNA CTD PMID:22378314 Dusp6 Rat thiabendazole multiple interactions EXP 6480464 [azoxystrobin co-treated with 2-chloro-N-(4-chlorobiphenyl-2-yl)nicotinamide co-treated with Chlorpyrifos co-treated with Glyphosate co-treated with imidacloprid co-treated with Thiabendazole] results in increased expression of DUSP6 mRNA CTD PMID:33854195 Dusp6 Rat thioacetamide increases expression EXP 6480464 Thioacetamide results in increased expression of DUSP6 mRNA CTD PMID:34492290 Dusp6 Rat titanium dioxide increases expression ISO Dusp6 (Mus musculus) 6480464 titanium dioxide results in increased expression of DUSP6 mRNA CTD PMID:23557971 Dusp6 Rat titanium dioxide decreases methylation ISO Dusp6 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DUSP6 gene and titanium dioxide results in decreased methylation of DUSP6 promoter CTD PMID:35295148 Dusp6 Rat titanium dioxide decreases expression ISO Dusp6 (Mus musculus) 6480464 titanium dioxide results in decreased expression of DUSP6 mRNA CTD PMID:29264374 Dusp6 Rat titanium dioxide affects expression ISO Dusp6 (Mus musculus) 6480464 titanium dioxide affects the expression of DUSP6 mRNA CTD PMID:17656681 Dusp6 Rat toluene decreases expression EXP 6480464 Toluene results in decreased expression of DUSP6 mRNA CTD PMID:22166486 Dusp6 Rat toluene increases expression EXP 6480464 Toluene results in increased expression of DUSP6 mRNA CTD PMID:22166486 Dusp6 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in increased expression of DUSP6 mRNA CTD PMID:25729387 Dusp6 Rat topotecan increases expression EXP 6480464 Topotecan results in increased expression of DUSP6 mRNA CTD PMID:25729387 Dusp6 Rat trametinib multiple interactions ISO DUSP6 (Homo sapiens) 6480464 [sotorasib co-treated with trametinib co-treated with NVP-BKM120] results in decreased expression of DUSP6 mRNA CTD PMID:36139627 Dusp6 Rat triadimefon increases expression EXP 6480464 triadimefon results in increased expression of DUSP6 mRNA CTD PMID:30047161 Dusp6 Rat Tributyltin oxide increases expression ISO DUSP6 (Homo sapiens) 6480464 bis(tri-n-butyltin)oxide results in increased expression of DUSP6 mRNA CTD PMID:24247028 Dusp6 Rat trichloroethene increases expression EXP 6480464 Trichloroethylene results in increased expression of DUSP6 mRNA CTD PMID:33387578 Dusp6 Rat trichostatin A decreases expression ISO DUSP6 (Homo sapiens) 6480464 trichostatin A results in decreased expression of DUSP6 mRNA CTD PMID:26272509 Dusp6 Rat triclosan decreases expression ISO DUSP6 (Homo sapiens) 6480464 Triclosan results in decreased expression of DUSP6 mRNA CTD PMID:30510588 Dusp6 Rat triphenyl phosphate affects expression ISO DUSP6 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DUSP6 mRNA CTD PMID:37042841 Dusp6 Rat troglitazone decreases expression EXP 6480464 troglitazone results in decreased expression of DUSP6 mRNA CTD PMID:21515302 Dusp6 Rat tunicamycin decreases expression ISO DUSP6 (Homo sapiens) 6480464 Tunicamycin results in decreased expression of DUSP6 mRNA CTD PMID:22378314 and PMID:29453283 Dusp6 Rat tunicamycin increases expression ISO DUSP6 (Homo sapiens) 6480464 Tunicamycin results in increased expression of DUSP6 mRNA CTD PMID:33545341 Dusp6 Rat urethane increases expression ISO DUSP6 (Homo sapiens) 6480464 Urethane results in increased expression of DUSP6 mRNA CTD PMID:28818685 Dusp6 Rat valproic acid affects expression ISO DUSP6 (Homo sapiens) 6480464 Valproic Acid affects the expression of DUSP6 mRNA CTD PMID:25979313 Dusp6 Rat valproic acid increases expression ISO DUSP6 (Homo sapiens) 6480464 Valproic Acid results in increased expression of DUSP6 mRNA CTD PMID:28001369 and PMID:29154799 Dusp6 Rat valproic acid decreases expression ISO DUSP6 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DUSP6 mRNA CTD PMID:23179753 more ... Dusp6 Rat vanillin decreases expression ISO DUSP6 (Homo sapiens) 6480464 vanillin results in decreased expression of DUSP6 mRNA CTD PMID:17178418 Dusp6 Rat vinclozolin increases expression EXP 6480464 vinclozolin results in increased expression of DUSP6 mRNA CTD PMID:23869203 Dusp6 Rat vinclozolin affects expression EXP 6480464 vinclozolin affects the expression of DUSP6 mRNA CTD PMID:19015723 Dusp6 Rat vinclozolin decreases expression EXP 6480464 vinclozolin results in decreased expression of DUSP6 mRNA CTD PMID:20566332 Dusp6 Rat zoledronic acid decreases expression ISO DUSP6 (Homo sapiens) 6480464 zoledronic acid results in decreased expression of DUSP6 mRNA CTD PMID:24714768
Imported Annotations - KEGG (archival)
(-)-alpha-phellandrene (ISO) (-)-anisomycin (ISO) (-)-demecolcine (ISO) (-)-epigallocatechin 3-gallate (ISO) (S)-nicotine (ISO) 1,2-dimethylhydrazine (ISO) 1,3-dinitrobenzene (EXP) 1-naphthyl isothiocyanate (EXP) 1-nitropyrene (ISO) 17alpha-ethynylestradiol (EXP) 17beta-estradiol (EXP,ISO) 2,2',4,4',5,5'-hexachlorobiphenyl (EXP,ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,4-diaminotoluene (ISO) 2-butoxyethanol (ISO) 2-hydroxypropanoic acid (ISO) 2-methylcholine (ISO) 2-nitrofluorene (EXP) 2-palmitoylglycerol (ISO) 3,3',4,4',5-pentachlorobiphenyl (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3,4-methylenedioxymethamphetamine (ISO) 3-chloropropane-1,2-diol (EXP) 3-isobutyl-1-methyl-7H-xanthine (ISO) 3-methylcholanthrene (ISO) 3-phenylprop-2-enal (ISO) 4,4'-diaminodiphenylmethane (EXP) 4,4'-sulfonyldiphenol (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-hydroxyphenyl retinamide (ISO) 5-aza-2'-deoxycytidine (ISO) 5-azacytidine (ISO) 5-bromo-2'-deoxyuridine (ISO) 5-fluorouracil (ISO) 6-propyl-2-thiouracil (EXP) 8-Br-cAMP (ISO) acetylsalicylic acid (EXP) acrylamide (EXP) ADP (ISO) aflatoxin B1 (EXP,ISO) aldehydo-D-glucose (ISO) alendronic acid (EXP) all-trans-retinoic acid (ISO) alpha-phellandrene (ISO) amitrole (EXP) ammonium chloride (EXP) antirheumatic drug (ISO) aripiprazole (ISO) aristolochic acid A (ISO) arsenite(3-) (ISO) ATP (ISO) atrazine (ISO) Azaspiracid (ISO) azoxystrobin (EXP) benzene-1,2,4-triol (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) beta-naphthoflavone (ISO) bis(2-ethylhexyl) phthalate (ISO) bisphenol A (EXP,ISO) bisphenol F (ISO) bromobenzene (EXP) butanal (ISO) C.I. Natural Red 20 (ISO) cadmium atom (ISO) cadmium dichloride (EXP,ISO) Calcimycin (ISO) calciol (ISO) cannabidiol (ISO) captan (ISO) carbon nanotube (ISO) casticin (ISO) cefaloridine (EXP) ceruletide (EXP) chlorpyrifos (EXP) chromium(6+) (ISO) ciguatoxin CTX1B (ISO) cisplatin (EXP,ISO) clobetasol (ISO) clofibrate (ISO) clozapine (EXP) cobalt dichloride (ISO) copper atom (EXP,ISO) copper(0) (EXP,ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) crocidolite asbestos (ISO) Cuprizon (EXP) cyclosporin A (ISO) D-glucose (ISO) D-penicillamine (EXP) deoxynivalenol (ISO) dexamethasone (ISO) dibutyl phthalate (EXP,ISO) dichloroacetic acid (ISO) diethyl maleate (ISO) diethylstilbestrol (EXP,ISO) dimethylarsinic acid (ISO) dioxygen (EXP,ISO) diuron (ISO) divanadium pentaoxide (ISO) dizocilpine maleate (EXP) dorsomorphin (ISO) doxorubicin (ISO) endosulfan (EXP) epoxiconazole (ISO) ethanol (ISO) fentin chloride (EXP) fluoranthene (ISO) flutamide (EXP) folic acid (ISO) folpet (ISO) fonofos (ISO) formaldehyde (ISO) furan (ISO) genistein (ISO) glucose (ISO) glyphosate (EXP,ISO) haloperidol (EXP) hydrogen peroxide (ISO) hydroquinone (ISO) imidacloprid (EXP) indometacin (ISO) irinotecan (EXP) L-ascorbic acid (EXP) leflunomide (ISO) lipopolysaccharide (ISO) manganese(II) chloride (EXP) menadione (ISO) metacetamol (ISO) methamphetamine (EXP) methapyrilene (EXP) methimazole (EXP) methylarsonic acid (ISO) methylisothiazolinone (ISO) methylmercury chloride (ISO) methylmercury(1+) (EXP) mono(2-ethylhexyl) phthalate (EXP,ISO) morphine (ISO) Muraglitazar (EXP) N,N-diethyl-m-toluamide (EXP) N-(6-acetamidohexyl)acetamide (ISO) N-methyl-4-phenylpyridinium (ISO) N-methylformamide (ISO) N-nitrosodiethylamine (EXP,ISO) N-nitrosodimethylamine (EXP) N-Nitrosopyrrolidine (ISO) nickel dichloride (ISO) nicotine (ISO) obeticholic acid (ISO) oxaliplatin (EXP) ozone (ISO) paracetamol (ISO) parathion (ISO) PD 0325901 (ISO) pentanal (ISO) perfluorooctane-1-sulfonic acid (EXP) perfluorooctanoic acid (EXP) permethrin (EXP) phenethyl caffeate (EXP) phenobarbital (EXP,ISO) phenylephrine (EXP) phenylmercury acetate (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP,ISO) potassium chromate (ISO) pregnenolone 16alpha-carbonitrile (EXP) progesterone (ISO) propanal (ISO) quercetin (ISO) rac-lactic acid (ISO) raloxifene (EXP) rotenone (ISO) SB 203580 (ISO) SB 431542 (ISO) SCH 23390 (EXP) scopolamine (EXP) sevoflurane (EXP) Shikonin (ISO) silicon dioxide (ISO) sodium arsenate (ISO) sodium arsenite (ISO) sodium dichromate (EXP) sotorasib (ISO) succimer (ISO) sulforaphane (ISO) sunitinib (ISO) tebufenpyrad (ISO) temozolomide (ISO) terbufos (ISO) tert-butyl hydroperoxide (ISO) Tesaglitazar (EXP) testosterone (ISO) tetrachloromethane (ISO) thapsigargin (ISO) thiabendazole (EXP) thioacetamide (EXP) titanium dioxide (ISO) toluene (EXP) topotecan (EXP) trametinib (ISO) triadimefon (EXP) Tributyltin oxide (ISO) trichloroethene (EXP) trichostatin A (ISO) triclosan (ISO) triphenyl phosphate (ISO) troglitazone (EXP) tunicamycin (ISO) urethane (ISO) valproic acid (ISO) vanillin (ISO) vinclozolin (EXP) zoledronic acid (ISO)
1.
Irinotecan changes gene expression in the small intestine of the rat with breast cancer.
Bowen JM, etal., Cancer Chemother Pharmacol. 2007 Feb;59(3):337-48. Epub 2006 Jun 24.
2.
Induction of the mitogen-activated protein kinase phosphatase MKP3 by nerve growth factor in differentiating PC12.
Camps M, etal., FEBS Lett. 1998 Mar 27;425(2):271-6.
3.
Dual-specific phosphatase-6 (Dusp6) and ERK mediate AMPA receptor-induced oligodendrocyte death.
Domercq M, etal., J Biol Chem. 2011 Apr 1;286(13):11825-36. doi: 10.1074/jbc.M110.153049. Epub 2011 Feb 7.
4.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.
Rat ISS GO annotations from GOA human gene data--August 2006
GOA data from the GO Consortium
6.
Map kinase phosphatases (MKP's) are early responsive genes during induction of cerulein hyperstimulation pancreatitis.
Hofken T, etal., Biochem Biophys Res Commun. 2000 Sep 24;276(2):680-5.
7.
Mapping gene expression changes in the fetal rat testis following acute dibutyl phthalate exposure defines a complex temporal cascade of responding cell types.
Johnson KJ, etal., Biol Reprod. 2007 Dec;77(6):978-89. Epub 2007 Sep 19.
8.
Electroconvulsive seizures increase the expression of MAP kinase phosphatases in limbic regions of rat brain.
Kodama M, etal., Neuropsychopharmacology. 2005 Feb;30(2):360-71.
9.
Regulation of MAP kinases by MAP kinase phosphatases.
Kondoh K and Nishida E, Biochim Biophys Acta. 2007 Aug;1773(8):1227-37. Epub 2006 Dec 8.
10.
Spinal cannabinoid receptor type 2 agonist reduces mechanical allodynia and induces mitogen-activated protein kinase phosphatases in a rat model of neuropathic pain.
Landry RP, etal., J Pain. 2012 Sep;13(9):836-48. doi: 10.1016/j.jpain.2012.05.013. Epub 2012 Aug 14.
11.
Gene Data Set
MGD Curation, June 12, 2002
12.
Rat ISS GO annotations from MGI mouse gene data--August 2006
MGD data from the GO Consortium
13.
A novel cytoplasmic dual specificity protein tyrosine phosphatase implicated in muscle and neuronal differentiation.
Mourey RJ, etal., J Biol Chem 1996 Feb 16;271(7):3795-802.
14.
MKP-3, a novel cytosolic protein-tyrosine phosphatase that exemplifies a new class of mitogen-activated protein kinase phosphatase.
Muda M, etal., J Biol Chem 1996 Feb 23;271(8):4319-26.
15.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
16.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
17.
Changes in gene expression induced by tienilic Acid and sulfamethoxazole: testing the danger hypothesis.
Pacitto SR, etal., J Immunotoxicol. 2007 Oct;4(4):253-66.
18.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
19.
GOA pipeline
RGD automated data pipeline
20.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
21.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
22.
Spinal mitogen-activated protein kinase phosphatase-3 (MKP-3) is necessary for the normal resolution of mechanical allodynia in a mouse model of acute postoperative pain.
Saha M, etal., J Neurosci. 2013 Oct 23;33(43):17182-7. doi: 10.1523/JNEUROSCI.5605-12.2013.
23.
Parallel gene expression monitoring using oligonucleotide probe arrays of multiple transcripts with an animal model of focal ischemia.
Soriano MA, etal., J Cereb Blood Flow Metab. 2000 Jul;20(7):1045-55.
24.
CD40-modulated dual-specificity phosphatases MAPK phosphatase (MKP)-1 and MKP-3 reciprocally regulate Leishmania major infection.
Srivastava N, etal., J Immunol. 2011 May 15;186(10):5863-72. doi: 10.4049/jimmunol.1003957. Epub 2011 Apr 6.
25.
Two kinds of mitogen-activated protein kinase phosphatases, MKP-1 and MKP-3, are differentially activated by acute and chronic methamphetamine treatment in the rat brain.
Takaki M, etal., J Neurochem. 2001 Nov;79(3):679-88.
26.
Overexpression of mitogen-activated protein kinase phosphatases MKP1, MKP2 in human breast cancer.
Wang HY, etal., Cancer Lett. 2003 Mar 10;191(2):229-37.
Dusp6 (Rattus norvegicus - Norway rat)
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 7 35,979,502 - 35,983,834 (+) NCBI GRCr8 mRatBN7.2 7 34,092,848 - 34,097,186 (+) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 7 34,092,943 - 34,097,185 (+) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 7 36,079,912 - 36,084,149 (+) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 7 38,261,675 - 38,265,912 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 7 37,995,062 - 37,999,297 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 7 41,475,163 - 41,479,393 (+) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 7 41,475,163 - 41,479,392 (+) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 7 41,506,397 - 41,510,627 (+) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 7 36,893,264 - 36,897,494 (+) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 7 36,913,534 - 36,917,764 (+) NCBI Celera 7 31,106,671 - 31,110,901 (+) NCBI Celera Cytogenetic Map 7 q13 NCBI
DUSP6 (Homo sapiens - human)
Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 12 89,347,235 - 89,352,501 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 12 89,347,235 - 89,352,501 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 12 89,741,012 - 89,746,278 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 12 88,265,968 - 88,270,427 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 12 88,244,306 - 88,248,764 NCBI Celera 12 89,413,532 - 89,417,991 (-) NCBI Celera Cytogenetic Map 12 q21.33 NCBI HuRef 12 86,807,701 - 86,812,160 (-) NCBI HuRef CHM1_1 12 89,706,790 - 89,711,249 (-) NCBI CHM1_1 T2T-CHM13v2.0 12 89,329,179 - 89,334,445 (-) NCBI T2T-CHM13v2.0
Dusp6 (Mus musculus - house mouse)
Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 10 99,098,676 - 99,103,351 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 10 99,099,093 - 99,103,351 (+) Ensembl GRCm39 Ensembl GRCm38 10 99,263,231 - 99,267,489 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 10 99,263,231 - 99,267,489 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 10 98,725,865 - 98,730,123 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 10 98,692,919 - 98,697,172 (+) NCBI MGSCv36 mm8 Celera 10 101,235,116 - 101,239,374 (+) NCBI Celera Cytogenetic Map 10 D1 NCBI cM Map 10 51.13 NCBI
Dusp6 (Chinchilla lanigera - long-tailed chinchilla)
Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955405 26,662,018 - 26,666,314 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955405 26,662,018 - 26,666,314 (-) NCBI ChiLan1.0 ChiLan1.0
DUSP6 (Pan paniscus - bonobo/pygmy chimpanzee)
Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 10 97,374,395 - 97,379,496 (-) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 12 97,370,793 - 97,375,021 (-) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 12 86,875,289 - 86,879,731 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 12 90,195,482 - 90,200,321 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 12 90,195,482 - 90,200,321 (-) Ensembl panpan1.1 panPan2
DUSP6 (Canis lupus familiaris - dog)
Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 15 30,322,472 - 30,327,221 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 15 30,323,697 - 30,326,508 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 15 30,777,953 - 30,782,527 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 15 30,967,877 - 30,972,449 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 15 30,968,620 - 30,972,415 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 15 30,272,051 - 30,276,623 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 15 30,333,920 - 30,338,490 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 15 30,628,124 - 30,632,696 (-) NCBI UU_Cfam_GSD_1.0
Dusp6 (Ictidomys tridecemlineatus - thirteen-lined ground squirrel)
Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404945 29,921,860 - 29,926,322 (+) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936507 6,308,886 - 6,313,935 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936507 6,309,114 - 6,314,512 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
DUSP6 (Sus scrofa - pig)
DUSP6 (Chlorocebus sabaeus - green monkey)
Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 11 84,741,957 - 84,747,038 (-) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 11 84,741,444 - 84,745,886 (-) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666037 160,455,940 - 160,460,447 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dusp6 (Heterocephalus glaber - naked mole-rat)
.
Predicted Target Of
Count of predictions: 341 Count of miRNA genes: 196 Interacting mature miRNAs: 226 Transcripts: ENSRNOT00000037844 Prediction methods: Microtar, Miranda, Targetscan Result types: miRGate_prediction
1354644 Spl4 Serum phospholipid level QTL 4 4.9 blood phospholipid amount (VT:0006084) blood phospholipid level (CMO:0001169) 7 19654317 49753746 Rat 7411569 Bw137 Body weight QTL 137 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 7 21921195 66921195 Rat 9590102 Sffal5 Serum free fatty acids level QTL 5 8.62 0.001 blood free fatty acid amount (VT:0001553) plasma free fatty acids level (CMO:0000546) 7 5329019 50329019 Rat 1578652 Bmd15 Bone mineral density QTL 15 5.2 femur mineral mass (VT:0010011) trabecular volumetric bone mineral density (CMO:0001729) 7 9866467 60460686 Rat 1641885 Alcrsp9 Alcohol response QTL 9 alcohol metabolism trait (VT:0015089) blood ethanol level (CMO:0000535) 7 24099606 69099606 Rat 631503 Bp102 Blood pressure QTL 102 1.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 7 1 44822433 Rat 1549840 Bss5 Bone structure and strength QTL 5 9.8 femur strength trait (VT:0010010) femur midshaft polar moment of inertia (CMO:0001669) 7 24751841 69751841 Rat 10755438 Coatc9 Coat color QTL 9 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 3529280 48529280 Rat 1300127 Srn1 Serum renin concentration QTL 1 3.87 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 7 29409683 84928080 Rat 2298547 Neuinf5 Neuroinflammation QTL 5 3.7 nervous system integrity trait (VT:0010566) spinal cord Cd74 protein level (CMO:0002131) 7 9462246 58265113 Rat 10059592 Kidm45 Kidney mass QTL 45 3.95 0.025 kidney mass (VT:0002707) both kidneys wet weight to body weight ratio (CMO:0000340) 7 7573985 52573985 Rat 2317047 Wbc4 White blood cell count QTL 4 0.01 leukocyte quantity (VT:0000217) white blood cell count (CMO:0000027) 7 1 35342956 Rat 10755440 Coatc10 Coat color QTL 10 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 7496499 52496499 Rat 1354637 Scl30 Serum cholesterol level QTL 30 3.7 blood cholesterol amount (VT:0000180) blood total cholesterol level (CMO:0000051) 7 19654317 49753746 Rat 10755453 Coatc12 Coat color QTL 12 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 31112832 76112832 Rat 1354639 Spl5 Serum phospholipid level QTL 5 3.9 blood LDL phospholipid amount (VT:0010505) blood low density lipoprotein phospholipid level (CMO:0001568) 7 19654317 52888450 Rat 10755451 Coatc11 Coat color QTL 11 0 coat/hair pigmentation trait (VT:0010463) pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812) 7 17944357 62944357 Rat 2317059 Aia15 Adjuvant induced arthritis QTL 15 2.46 joint integrity trait (VT:0010548) right rear ankle joint diameter (CMO:0002150) 7 17004598 62004598 Rat 61410 Bw19 Body weight QTL 19 6.2 0.001 body mass (VT:0001259) body weight (CMO:0000012) 7 1 44782185 Rat 1643004 Pain2 Pain QTL 2 1 mechanical nociception trait (VT:0002734) self mutilation severity score (CMO:0002145) 7 9462246 98011544 Rat 634336 Anxrr17 Anxiety related response QTL 17 3.66 locomotor behavior trait (VT:0001392) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 7 924703 115097879 Rat 1582260 Bw72 Body weight QTL 72 3.2 0.0043 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582261 Bw69 Body weight QTL 69 3.2 0.0048 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 1582262 Bw75 Body weight QTL 75 3 0.0038 body mass (VT:0001259) body weight (CMO:0000012) 7 15795565 38073970 Rat 70190 Mcs6 Mammary carcinoma susceptibility QTL 6 2.29 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 26737401 63902784 Rat 1300132 Bp182 Blood pressure QTL 182 3.49 arterial blood pressure trait (VT:2000000) blood pressure time series experimental set point of the baroreceptor response (CMO:0002593) 7 19654317 84928080 Rat 61369 Mcs2 Mammary carcinoma susceptibility QTL 2 3.38 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 7 19032807 35526300 Rat 1300138 Hrtrt9 Heart rate QTL 9 4.72 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 7 29409683 53612950 Rat 10402855 Bp379 Blood pressure QTL 379 0.21 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 7 29409683 74409683 Rat 738033 Anxrr6 Anxiety related response QTL 6 4.1 exploratory behavior trait (VT:0010471) percentage of entries into a discrete space in an experimental apparatus (CMO:0000961) 7 15573889 60573889 Rat
RH133891
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 34,096,224 - 34,096,428 (+) MAPPER mRatBN7.2 Rnor_6.0 7 41,478,432 - 41,478,635 NCBI Rnor6.0 Rnor_5.0 7 41,509,666 - 41,509,869 UniSTS Rnor5.0 RGSC_v3.4 7 36,896,533 - 36,896,736 UniSTS RGSC3.4 Celera 7 31,109,940 - 31,110,143 UniSTS RH 3.4 Map 7 279.6 UniSTS Cytogenetic Map 7 q13 UniSTS
WI-14395
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 7 34,094,672 - 34,095,830 (+) MAPPER mRatBN7.2 Rnor_6.0 7 41,476,880 - 41,478,037 NCBI Rnor6.0 Rnor_5.0 7 41,508,114 - 41,509,271 UniSTS Rnor5.0 RGSC_v3.4 7 36,894,981 - 36,896,138 UniSTS RGSC3.4 Celera 7 31,108,388 - 31,109,545 UniSTS Cytogenetic Map 7 q13 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000037844 ⟹ ENSRNOP00000032969
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 34,092,943 - 34,097,185 (+) Ensembl Rnor_6.0 Ensembl 7 41,475,163 - 41,479,392 (+) Ensembl
Ensembl Acc Id:
ENSRNOT00000111909 ⟹ ENSRNOP00000087245
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 7 34,093,076 - 34,097,181 (+) Ensembl
RefSeq Acc Id:
NM_053883 ⟹ NP_446335
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 35,979,604 - 35,983,834 (+) NCBI mRatBN7.2 7 34,092,956 - 34,097,186 (+) NCBI Rnor_6.0 7 41,475,163 - 41,479,393 (+) NCBI Rnor_5.0 7 41,506,397 - 41,510,627 (+) NCBI RGSC_v3.4 7 36,893,264 - 36,897,494 (+) RGD Celera 7 31,106,671 - 31,110,901 (+) RGD
Sequence:
CTGCCTGGCACAGGGGGTGTGCTCTCGCGGAGTCCTAGGGACTGCGAGCAAACCCAGTCTTGAATAATCCGGCGAGAAACACGGGGTTGGATCTGAGGTGCAGCCTCAGAGGGATTAGGAGCTGCTAG ACTTTTTTCTTTTTTCCTTTTTCTCCTCTCAGTGGCACGGAGTCCGAATTAATTGGATTTCATTCACTGGGTAGGAACAAAACTGGGCACTTTCATTCAGAGAGATTCATTGACTCTGAGAGTGATCT GGTGCAGAGGGACCACCGGCTTGGCTTCTGTCGCCTTCCCTAACCGCTAGCTTCGGCTTGGGAAAGGCCGAATCAAACCCGGCTCCGAGAGCCGGAGCTTCTCACGGCGTGCTTGGCCTATGCCTGCC TCGAGGGGCGTCTGCTAGGCACCCCGCCTTCTCCTGCAGCTCGACCCCCATGATAGATACGCTCAGACCCGTGCCCTTCGCGTCGGAAATGGCGATCAGCAAGACGGTGGCGTGGCTCAACGAGCAGC TGGAGCTGGGCAACGAACAGCTGCTGCTGATGGACTGCCGACCGCAGGAGCTGTACGAGTCGTCGCACATCGAATCTGCCATCAACGTGGCCATCCCGGGCATCATGCTGCGGCGTCTGCAGAAGGGC AACCTGCCGGTGCGCGCGCTATTCACGCGCTGCGAGGACCGGGACCGCTTTACCAGGCGCTGCGGCACCGACACCGTGGTGCTCTACGACGAGAACAGCAGCGACTGGAATGAGAACACAGGTGGAGA GTCGGTCCTCGGGCTGCTGCTCAAGAAACTCAAAGACGAGGGCTGCCGGGCGTTCTACCTTGAAGGTGGCTTCAGTAAGTTCCAGGCCGAGTTCGCCCTGCACTGCGAGACCAATCTAGACGGCTCGT GCAGCAGCAGCTCCCCGCCCTTGCCAGTGCTGGGACTCGGGGGCCTGAGGATCAGCTCCGACTCTTCCTCGGACATTGAGTCTGACCTTGACCGAGACCCCAATAGTGCAACGGACTCCGATGGCAGC CCGCTGTCCAACAGCCAGCCTTCCTTCCCGGTGGAGATTTTGCCCTTCCTTTACCTGGGCTGTGCCAAGGACTCTACTAACTTGGACGTGTTGGAAGAGTTTGGCATCAAGTACATCTTGAACGTCAC CCCCAATCTGCCCAATCTGTTTGAGAATGCAGGGGAGTTCAAGTACAAGCAAATTCCTATCTCTGATCACTGGAGCCAAAACCTGTCCCAGTTTTTCCCTGAGGCCATTTCTTTCATAGATGAAGCCC GAGGCAAAAACTGTGGTGTCCTGGTGCATTGCTTGGCGGGCATCAGCCGCTCCGTCACGGTGACAGTGGCTTACCTTATGCAGAAGCTCAACTTGTCCATGAACGATGCTTATGACATTGTCAAAATG AAGAAGTCCAACATCTCTCCCAACTTCAACTTCATGGGCCAGCTGCTTGACTTTGAAAGGACCCTGGGACTCAGCAGCCCCTGTGACAATCGTGTCCCCGCACAGCAGCTCTACTTCACCGCGCCCTC CAACCAGAATGTCTACCAAGTGGACTCCCTGCAATCTACGTGAAAGGCACCCACCTTTCCTAGCCGGGAGTGTCTCATTCCTTCAGTTTCTCTTGGGCAGCATCGACCAGGCTGCTTTCTTTGTGTGT GGCCCCAGGTGTCAAAAATGTCACCAGCTGTCTGTATTAGACAAGGTTGCCAAGTGCAAAATTGGTTATTACGGAGGGAGAGATTTGCTCCATTCATTGTTTTTTGGAAGGACAGGGTATGCTGTCTA GATCCAGGCAATAGGTTTGCTTCTGTACCCCAGCCTACCCAAGCAGGGACTGGACCTCCATCCAGATAGAGGGTAGGACAAAGGAGCCGGGGATAGGAGCATGTGTTCCTTAGGGCCACATATGGCTG TTTCCTGTTGCATCTGGAACCAACTATATTGTCTTCAGTGAAGACTGATTCAACTTTGCGTATAGTGGAGCCAAAGAGATTTTAGCTCTGTATTTGTGGTATCGGTTTTGAAAACAAAAGAACTGATC CTTTAATTTGATTATTGTAAATATTTGATCTTCACTTGAGAGTGTTTGTTTGGCTTGTGTTTGGTTTTTAATCTTTGGGTTTAAACGAGATCCAAAGGGAGAAAGAGCAGTATGCCACTTCTTAGAAC AAAAAAAAAAAAAAATGGTTCTTTTCTAATCCAAAGGGTATATTTGCAGCATGCTTGACCTTACTGTACCAATTCTGGTTTTCACGGATATTATGATCACTAAGACTTTGTTATGATGAGGTCTTCAG TCTCTTTCATGTATCTTCCTTGTAACTTTATTTTTTCTCTTAATGTAGTTTTGACTCTGCCTTACCTTTGTAAATATTTGGCTTACGTTGTCTCAAGGGGTATTTTCGAAAGACACCAAAATTGTGGA TTCACTTTTTTTTTTTTTTTTTTTAGTAACTTCAGCTGTGCTTAAACAGCCTATTACCTCTGTACAAAATTCTTCAGGGAGTGTCACCTCAAATGCAATACGTTGGGTTGGTCTCTTTCCTTTAAAAA AAAAATATACAAAACTGGAAGTGTGTGTATGTATGTATGTGAGCATGCTCGCCCATTCAACGGGTGGGATGCGACAGGTTGTGAGGAAGGGAAAGTTCACTTGCTCCATGATGTTCGTGGTGTAAAGT TTTGAGCTGGAATTTATTATAAGAATGTAAAACCTTAAATTATTAATAAATAACTATTTTGGCTATTGAAAAAAAAAAAAAAAAAAAAAAAAA
hide sequence
RefSeq Acc Id:
XM_039078252 ⟹ XP_038934180
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 7 35,979,502 - 35,983,830 (+) NCBI mRatBN7.2 7 34,092,848 - 34,097,183 (+) NCBI
RefSeq Acc Id:
NP_446335 ⟸ NM_053883
- UniProtKB:
Q64346 (UniProtKB/Swiss-Prot), A6IG82 (UniProtKB/TrEMBL)
- Sequence:
MIDTLRPVPFASEMAISKTVAWLNEQLELGNEQLLLMDCRPQELYESSHIESAINVAIPGIMLRRLQKGNLPVRALFTRCEDRDRFTRRCGTDTVVLYDENSSDWNENTGGESVLGLLLKKLKDEGCR AFYLEGGFSKFQAEFALHCETNLDGSCSSSSPPLPVLGLGGLRISSDSSSDIESDLDRDPNSATDSDGSPLSNSQPSFPVEILPFLYLGCAKDSTNLDVLEEFGIKYILNVTPNLPNLFENAGEFKYK QIPISDHWSQNLSQFFPEAISFIDEARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTAPSNQNVYQVDSLQST
hide sequence
Ensembl Acc Id:
ENSRNOP00000032969 ⟸ ENSRNOT00000037844
RefSeq Acc Id:
XP_038934180 ⟸ XM_039078252
- Peptide Label:
isoform X1
- UniProtKB:
A0A8L2QHD1 (UniProtKB/TrEMBL)
Ensembl Acc Id:
ENSRNOP00000087245 ⟸ ENSRNOT00000111909
RGD ID: 13695174
Promoter ID: EPDNEW_R5699
Type: multiple initiation site
Name: Dusp6_1
Description: dual specificity phosphatase 6
SO ACC ID: SO:0000170
Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ )
Experiment Methods: Single-end sequencing.
Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 7 41,475,150 - 41,475,210 EPDNEW
BioCyc Gene
G2FUF-34271
BioCyc
Ensembl Genes
ENSRNOG00000023896
Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript
ENSRNOT00000037844
ENTREZGENE
ENSRNOT00000037844.4
UniProtKB/TrEMBL
ENSRNOT00000111909
ENTREZGENE
ENSRNOT00000111909.1
UniProtKB/Swiss-Prot
Gene3D-CATH
3.40.250.10
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
3.90.190.10
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE
IMAGE:7124105
IMAGE-MGC_LOAD
InterPro
Dual-sp_phosphatase_cat-dom
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MKP
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Prot-tyrosine_phosphatase-like
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Rhodanese-like_dom
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Rhodanese-like_dom_sf
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Tyr_Pase_dom
UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
TYR_PHOSPHATASE_DUAL_dom
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report
rno:116663
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE
MGC:93276
IMAGE-MGC_LOAD
NCBI Gene
116663
ENTREZGENE
PANTHER
DUAL SPECIFICITY PROTEIN PHOSPHATASE
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
DUAL SPECIFICITY PROTEIN PHOSPHATASE 6
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam
DSPc
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Rhodanese
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen
Dusp6
PhenoGen
PIRSF
MAPK_Ptase
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PRINTS
MAPKPHPHTASE
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE
RHODANESE_3
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TYR_PHOSPHATASE_2
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TYR_PHOSPHATASE_DUAL
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx
ENSRNOG00000023896
RatGTEx
SMART
DSPc
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RHOD
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP
SSF52799
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SSF52821
UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt
A0A8L2QHD1
ENTREZGENE, UniProtKB/TrEMBL
A6IG82
ENTREZGENE, UniProtKB/TrEMBL
DUS6_RAT
UniProtKB/Swiss-Prot, ENTREZGENE
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2002-07-09
Dusp6
dual specificity phosphatase 6
Symbol and Name updated to reflect Human and Mouse nomenclature
70877
APPROVED
Note Type
Note
Reference
gene_cellular_localization
localized to cytoplasm
70726