Symbol:
Cdk5rap2
Name:
CDK5 regulatory subunit associated protein 2
RGD ID:
708451
Description:
Predicted to enable several functions, including calmodulin binding activity; protein kinase binding activity; and tubulin binding activity. Involved in negative regulation of cyclin-dependent protein serine/threonine kinase activity. Predicted to be located in several cellular components, including Golgi apparatus; microtubule cytoskeleton; and perinuclear region of cytoplasm. Predicted to be part of gamma-tubulin ring complex. Predicted to be active in microtubule plus-end; mitotic spindle pole; and pericentriolar material. Human ortholog(s) of this gene implicated in Seckel syndrome; microcephaly; and primary autosomal recessive microcephaly 3. Orthologous to human CDK5RAP2 (CDK5 regulatory subunit associated protein 2); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; aconitine.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
CDK5 activator-binding protein C48; CDK5 regulatory subunit-associated protein 2; LOC286919
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 88,807,402 - 88,976,005 (-) NCBI GRCr8 mRatBN7.2 5 83,792,282 - 83,961,129 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 83,792,284 - 83,960,782 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 86,182,820 - 86,351,488 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 88,000,151 - 88,168,819 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 87,975,837 - 88,144,496 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 86,387,238 - 86,554,108 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 86,387,078 - 86,554,102 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 87,564,010 - 87,738,257 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 87,569,157 - 87,585,659 (-) NCBI Celera 5 82,598,401 - 82,765,611 (-) NCBI Celera Cytogenetic Map 5 q31 NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Cdk5rap2 Rat (-)-epigallocatechin 3-gallate multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CDK5RAP2 mRNA CTD PMID:22079256 Cdk5rap2 Rat 1,2-dichloroethane decreases expression ISO Cdk5rap2 (Mus musculus) 6480464 ethylene dichloride results in decreased expression of CDK5RAP2 mRNA CTD PMID:28960355 Cdk5rap2 Rat 17beta-estradiol multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of CDK5RAP2 mRNA CTD PMID:20660070 Cdk5rap2 Rat 17beta-hydroxy-5alpha-androstan-3-one decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Dihydrotestosterone results in decreased expression of CDK5RAP2 mRNA CTD PMID:18007998 Cdk5rap2 Rat 2,3',4,4',5-Pentachlorobiphenyl increases expression ISO Cdk5rap2 (Mus musculus) 6480464 2 more ... CTD PMID:31388691 Cdk5rap2 Rat 2,3,7,8-tetrachlorodibenzodioxine affects expression ISO Cdk5rap2 (Mus musculus) 6480464 Tetrachlorodibenzodioxin affects the expression of CDK5RAP2 mRNA CTD PMID:21570461 and PMID:24680724 Cdk5rap2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression EXP 6480464 Tetrachlorodibenzodioxin results in increased expression of CDK5RAP2 mRNA CTD PMID:34747641 Cdk5rap2 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of CDK5RAP2 mRNA CTD PMID:32109520 Cdk5rap2 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of CDK5RAP2 mRNA CTD PMID:20106945 more ... Cdk5rap2 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Cdk5rap2 Rat 2-methylcholine affects expression ISO CDK5RAP2 (Homo sapiens) 6480464 beta-methylcholine affects the expression of CDK5RAP2 mRNA CTD PMID:21179406 Cdk5rap2 Rat 2-palmitoylglycerol increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 2-palmitoylglycerol results in increased expression of CDK5RAP2 mRNA CTD PMID:37199045 Cdk5rap2 Rat 4,4'-sulfonyldiphenol decreases methylation ISO CDK5RAP2 (Homo sapiens) 6480464 bisphenol S results in decreased methylation of CDK5RAP2 gene CTD PMID:31601247 Cdk5rap2 Rat aconitine decreases expression EXP 6480464 Aconitine results in decreased expression of CDK5RAP2 protein CTD PMID:33236894 Cdk5rap2 Rat acrolein multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CDK5RAP2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of CDK5RAP2 mRNA CTD PMID:32699268 Cdk5rap2 Rat allethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of CDK5RAP2 protein CTD PMID:34896426 Cdk5rap2 Rat alpha-pinene multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CDK5RAP2 mRNA and [Air Pollutants results in increased abundance of [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone]] which results in increased oxidation of CDK5RAP2 mRNA CTD PMID:32699268 Cdk5rap2 Rat ammonium chloride affects expression EXP 6480464 Ammonium Chloride affects the expression of CDK5RAP2 mRNA CTD PMID:16483693 Cdk5rap2 Rat aristolochic acid A decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 aristolochic acid I results in decreased expression of CDK5RAP2 mRNA CTD PMID:33212167 Cdk5rap2 Rat arsenite(3-) multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 arsenite inhibits the reaction [G3BP1 protein binds to CDK5RAP2 mRNA] CTD PMID:32406909 Cdk5rap2 Rat atrazine affects methylation EXP 6480464 Atrazine affects the methylation of CDK5RAP2 gene CTD PMID:28931070 Cdk5rap2 Rat benzo[a]pyrene increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of CDK5RAP2 mRNA CTD PMID:20064835 more ... Cdk5rap2 Rat benzo[a]pyrene affects methylation ISO CDK5RAP2 (Homo sapiens) 6480464 Benzo(a)pyrene affects the methylation of CDK5RAP2 intron CTD PMID:30157460 Cdk5rap2 Rat benzo[a]pyrene increases methylation ISO Cdk5rap2 (Mus musculus) 6480464 Benzo(a)pyrene results in increased methylation of CDK5RAP2 intron CTD PMID:27901495 Cdk5rap2 Rat beta-lapachone decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 beta-lapachone results in decreased expression of CDK5RAP2 mRNA CTD PMID:38218311 Cdk5rap2 Rat beta-naphthoflavone increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 beta-Naphthoflavone results in increased expression of CDK5RAP2 mRNA CTD PMID:19737606 Cdk5rap2 Rat bisphenol A decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 bisphenol A results in decreased expression of CDK5RAP2 mRNA CTD PMID:18007998 Cdk5rap2 Rat bisphenol A increases methylation ISO CDK5RAP2 (Homo sapiens) 6480464 bisphenol A results in increased methylation of CDK5RAP2 gene CTD PMID:31601247 Cdk5rap2 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of CDK5RAP2 mRNA CTD PMID:30816183 Cdk5rap2 Rat bisphenol A increases methylation EXP 6480464 bisphenol A results in increased methylation of CDK5RAP2 gene CTD PMID:28505145 Cdk5rap2 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of CDK5RAP2 mRNA CTD PMID:25181051 Cdk5rap2 Rat bisphenol A increases expression ISO Cdk5rap2 (Mus musculus) 6480464 bisphenol A results in increased expression of CDK5RAP2 mRNA CTD PMID:26063408 Cdk5rap2 Rat cadmium dichloride increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Cadmium Chloride results in increased expression of CDK5RAP2 mRNA CTD PMID:26472689 Cdk5rap2 Rat caffeine increases phosphorylation ISO CDK5RAP2 (Homo sapiens) 6480464 Caffeine results in increased phosphorylation of CDK5RAP2 protein CTD PMID:35688186 Cdk5rap2 Rat carbamazepine affects expression ISO CDK5RAP2 (Homo sapiens) 6480464 Carbamazepine affects the expression of CDK5RAP2 mRNA CTD PMID:25979313 Cdk5rap2 Rat CGP 52608 multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to CDK5RAP2 gene] CTD PMID:28238834 Cdk5rap2 Rat chlorpyrifos decreases expression ISO Cdk5rap2 (Mus musculus) 6480464 Chlorpyrifos results in decreased expression of CDK5RAP2 mRNA CTD PMID:37019170 Cdk5rap2 Rat cobalt dichloride increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 cobaltous chloride results in increased expression of CDK5RAP2 mRNA CTD PMID:22941251 Cdk5rap2 Rat copper(II) chloride increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 cupric chloride results in increased expression of CDK5RAP2 mRNA CTD PMID:38568856 Cdk5rap2 Rat copper(II) sulfate increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Copper Sulfate results in increased expression of CDK5RAP2 mRNA CTD PMID:19549813 Cdk5rap2 Rat coumestrol multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Cdk5rap2 Rat coumestrol increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Coumestrol results in increased expression of CDK5RAP2 mRNA CTD PMID:19167446 Cdk5rap2 Rat Cuprizon increases expression EXP 6480464 Cuprizone results in increased expression of CDK5RAP2 mRNA CTD PMID:27523638 Cdk5rap2 Rat cyclosporin A increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Cyclosporine results in increased expression of CDK5RAP2 mRNA CTD PMID:20106945 Cdk5rap2 Rat cyclosporin A decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of CDK5RAP2 mRNA CTD PMID:27989131 Cdk5rap2 Rat cyhalothrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of CDK5RAP2 protein CTD PMID:34896426 Cdk5rap2 Rat cypermethrin multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of CDK5RAP2 protein CTD PMID:34896426 Cdk5rap2 Rat dibutyl phthalate increases expression EXP 6480464 Dibutyl Phthalate results in increased expression of CDK5RAP2 mRNA CTD PMID:21266533 Cdk5rap2 Rat Enterolactone multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of CDK5RAP2 mRNA CTD PMID:19167446 Cdk5rap2 Rat fenvalerate multiple interactions EXP 6480464 [cypermethrin co-treated with decamethrin co-treated with fenvalerate co-treated with cyhalothrin co-treated with Allethrins] results in decreased expression of CDK5RAP2 protein CTD PMID:34896426 Cdk5rap2 Rat FR900359 increases phosphorylation ISO CDK5RAP2 (Homo sapiens) 6480464 FR900359 results in increased phosphorylation of CDK5RAP2 protein CTD PMID:37730182 Cdk5rap2 Rat GW 4064 multiple interactions ISO Cdk5rap2 (Mus musculus) 6480464 GW 4064 promotes the reaction [NR1H4 protein binds to CDK5RAP2 gene] CTD PMID:20091679 Cdk5rap2 Rat hydrogen peroxide affects expression ISO CDK5RAP2 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of CDK5RAP2 mRNA CTD PMID:21179406 Cdk5rap2 Rat lead(0) affects expression ISO CDK5RAP2 (Homo sapiens) 6480464 Lead affects the expression of CDK5RAP2 mRNA CTD PMID:28903495 Cdk5rap2 Rat lipopolysaccharide multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CDK5RAP2 mRNA CTD PMID:35811015 Cdk5rap2 Rat maneb multiple interactions ISO Cdk5rap2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of CDK5RAP2 mRNA more ... CTD PMID:23017109 Cdk5rap2 Rat methotrexate increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Methotrexate results in increased expression of CDK5RAP2 mRNA CTD PMID:24449571 Cdk5rap2 Rat N-nitrosodiethylamine increases expression EXP 6480464 Diethylnitrosamine results in increased expression of CDK5RAP2 mRNA CTD PMID:19041683 Cdk5rap2 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CDK5RAP2 mRNA CTD PMID:25729387 Cdk5rap2 Rat ozone multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased oxidation of CDK5RAP2 mRNA more ... CTD PMID:32699268 Cdk5rap2 Rat ozone multiple interactions ISO Cdk5rap2 (Mus musculus) 6480464 [Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased expression of CDK5RAP2 mRNA and [Air Pollutants results in increased abundance of Ozone] which results in increased expression of CDK5RAP2 mRNA CTD PMID:34911549 Cdk5rap2 Rat paracetamol increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Acetaminophen results in increased expression of CDK5RAP2 mRNA CTD PMID:22230336 Cdk5rap2 Rat paracetamol decreases expression EXP 6480464 Acetaminophen results in decreased expression of CDK5RAP2 mRNA CTD PMID:33387578 Cdk5rap2 Rat paracetamol decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Acetaminophen results in decreased expression of CDK5RAP2 mRNA CTD PMID:29067470 Cdk5rap2 Rat paraquat multiple interactions ISO Cdk5rap2 (Mus musculus) 6480464 [Maneb co-treated with Paraquat] results in increased expression of CDK5RAP2 mRNA more ... CTD PMID:23017109 Cdk5rap2 Rat potassium chromate multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [potassium chromate(VI) co-treated with epigallocatechin gallate] results in decreased expression of CDK5RAP2 mRNA CTD PMID:22079256 Cdk5rap2 Rat potassium chromate decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 potassium chromate(VI) results in decreased expression of CDK5RAP2 mRNA CTD PMID:22079256 Cdk5rap2 Rat progesterone multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [Estradiol co-treated with Progesterone] results in increased expression of CDK5RAP2 mRNA CTD PMID:20660070 Cdk5rap2 Rat pyrethrins decreases expression EXP 6480464 Pyrethrins results in decreased expression of CDK5RAP2 protein CTD PMID:34896426 Cdk5rap2 Rat quercetin increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Quercetin results in increased expression of CDK5RAP2 mRNA CTD PMID:21632981 Cdk5rap2 Rat resveratrol multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in increased expression of CDK5RAP2 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of CDK5RAP2 mRNA CTD PMID:19167446 and PMID:23557933 Cdk5rap2 Rat resveratrol increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 resveratrol results in increased expression of CDK5RAP2 mRNA CTD PMID:25436977 Cdk5rap2 Rat S-(1,2-dichlorovinyl)-L-cysteine multiple interactions ISO CDK5RAP2 (Homo sapiens) 6480464 [S-(1 and 2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of CDK5RAP2 mRNA CTD PMID:35811015 Cdk5rap2 Rat sodium arsenite increases expression ISO CDK5RAP2 (Homo sapiens) 6480464 sodium arsenite results in increased expression of CDK5RAP2 mRNA CTD PMID:38568856 Cdk5rap2 Rat tetrachloromethane decreases expression EXP 6480464 Carbon Tetrachloride results in decreased expression of CDK5RAP2 mRNA CTD PMID:31150632 Cdk5rap2 Rat thapsigargin increases expression ISO Cdk5rap2 (Mus musculus) 6480464 Thapsigargin results in increased expression of CDK5RAP2 protein CTD PMID:24648495 Cdk5rap2 Rat titanium dioxide decreases methylation ISO Cdk5rap2 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of CDK5RAP2 gene and titanium dioxide results in decreased methylation of CDK5RAP2 promoter CTD PMID:35295148 Cdk5rap2 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of CDK5RAP2 mRNA CTD PMID:25729387 Cdk5rap2 Rat triphenyl phosphate affects expression ISO CDK5RAP2 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of CDK5RAP2 mRNA CTD PMID:37042841 Cdk5rap2 Rat triptonide increases expression ISO Cdk5rap2 (Mus musculus) 6480464 triptonide results in increased expression of CDK5RAP2 mRNA CTD PMID:33045310 Cdk5rap2 Rat trovafloxacin decreases expression ISO Cdk5rap2 (Mus musculus) 6480464 trovafloxacin results in decreased expression of CDK5RAP2 mRNA CTD PMID:35537566 Cdk5rap2 Rat urethane decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Urethane results in decreased expression of CDK5RAP2 mRNA CTD PMID:28818685 Cdk5rap2 Rat valproic acid decreases expression ISO CDK5RAP2 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of CDK5RAP2 mRNA CTD PMID:23179753 and PMID:28001369 Cdk5rap2 Rat vinclozolin increases methylation EXP 6480464 vinclozolin results in increased methylation of CDK5RAP2 gene CTD PMID:31682807
(-)-epigallocatechin 3-gallate (ISO) 1,2-dichloroethane (ISO) 17beta-estradiol (ISO) 17beta-hydroxy-5alpha-androstan-3-one (ISO) 2,3',4,4',5-Pentachlorobiphenyl (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2-methylcholine (ISO) 2-palmitoylglycerol (ISO) 4,4'-sulfonyldiphenol (ISO) aconitine (EXP) acrolein (ISO) allethrin (EXP) alpha-pinene (ISO) ammonium chloride (EXP) aristolochic acid A (ISO) arsenite(3-) (ISO) atrazine (EXP) benzo[a]pyrene (ISO) beta-lapachone (ISO) beta-naphthoflavone (ISO) bisphenol A (EXP,ISO) cadmium dichloride (ISO) caffeine (ISO) carbamazepine (ISO) CGP 52608 (ISO) chlorpyrifos (ISO) cobalt dichloride (ISO) copper(II) chloride (ISO) copper(II) sulfate (ISO) coumestrol (ISO) Cuprizon (EXP) cyclosporin A (ISO) cyhalothrin (EXP) cypermethrin (EXP) dibutyl phthalate (EXP) Enterolactone (ISO) fenvalerate (EXP) FR900359 (ISO) GW 4064 (ISO) hydrogen peroxide (ISO) lead(0) (ISO) lipopolysaccharide (ISO) maneb (ISO) methotrexate (ISO) N-nitrosodiethylamine (EXP) oxaliplatin (EXP) ozone (ISO) paracetamol (EXP,ISO) paraquat (ISO) potassium chromate (ISO) progesterone (ISO) pyrethrins (EXP) quercetin (ISO) resveratrol (ISO) S-(1,2-dichlorovinyl)-L-cysteine (ISO) sodium arsenite (ISO) tetrachloromethane (EXP) thapsigargin (ISO) titanium dioxide (ISO) topotecan (EXP) triphenyl phosphate (ISO) triptonide (ISO) trovafloxacin (ISO) urethane (ISO) valproic acid (ISO) vinclozolin (EXP)
Biological Process
brain development (IEA,ISO,ISS) centriole replication (IBA,IEA,ISO) centrosome cycle (IEA,ISO,ISS) chromosome segregation (IBA,IEA,ISO,ISS) establishment of mitotic spindle orientation (IBA,IEA,ISO,ISS) microtubule bundle formation (IBA,IEA,ISO,ISS) microtubule cytoskeleton organization (IEA,ISO,ISS) microtubule organizing center organization (IEA,ISO,ISS) negative regulation of centriole replication (IBA,IEA,ISO,ISS) negative regulation of cyclin-dependent protein serine/threonine kinase activity (IDA) negative regulation of neuron differentiation (IEA,ISO) neurogenesis (IEA,ISO,ISS) positive regulation of DNA-templated transcription (IEA,ISO,ISS) positive regulation of microtubule polymerization (IEA,ISO) regulation of mitotic cell cycle spindle assembly checkpoint (IBA,IEA,ISO,ISS)
Cellular Component
cell junction (IEA,ISO) centrosome (IEA,ISO,ISS) ciliary basal body (IEA,ISO) cytoplasm (IEA,ISO,ISS) cytoskeleton (IEA) cytosol (IEA,ISO) gamma-tubulin ring complex (IEA,ISO) Golgi apparatus (IEA,ISO,ISS) microtubule (IEA,ISO,ISS) microtubule organizing center (IEA) microtubule plus-end (IBA,IEA,ISO,ISS) mitotic spindle pole (IBA,IEA,ISO) pericentriolar material (IBA,IEA,ISO,ISS) perinuclear region of cytoplasm (IEA,ISO,ISS) spindle pole (IEA,ISO,ISS)
Molecular Function
calmodulin binding (IEA,ISO,ISS) gamma-tubulin binding (IBA,IEA,ISO) microtubule binding (IBA,IEA,ISO) protein binding (ISO) protein kinase binding (IEA,ISO,ISS) protein-containing complex binding (IDA) transcription cis-regulatory region binding (IEA,ISO,ISS) tubulin binding (IEA,ISO)
1.
Cloning of three novel neuronal Cdk5 activator binding proteins.
Ching YP, etal., Gene 2000 Jan 25;242(1-2):285-94.
2.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.
Previously described sequence variant in CDK5RAP2 gene in a Pakistani family with autosomal recessive primary microcephaly.
Hassan MJ, etal., BMC Med Genet. 2007 Sep 1;8:58.
4.
Clinical and cellular features in patients with primary autosomal recessive microcephaly and a novel CDK5RAP2 mutation.
Issa L, etal., Orphanet J Rare Dis. 2013 Apr 15;8:59. doi: 10.1186/1750-1172-8-59.
5.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
6.
GOA pipeline
RGD automated data pipeline
7.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
9.
Identification of a common protein association region in the neuronal Cdk5 activator.
Wang X, etal., J Biol Chem 2000 Oct 13;275(41):31763-9.
10.
Mutations in CDK5RAP2 cause Seckel syndrome.
Yigit G, etal., Mol Genet Genomic Med. 2015 Sep;3(5):467-80. doi: 10.1002/mgg3.158. Epub 2015 May 24.
Cdk5rap2 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 5 88,807,402 - 88,976,005 (-) NCBI GRCr8 mRatBN7.2 5 83,792,282 - 83,961,129 (-) NCBI mRatBN7.2 mRatBN7.2 mRatBN7.2 Ensembl 5 83,792,284 - 83,960,782 (-) Ensembl mRatBN7.2 Ensembl UTH_Rnor_SHR_Utx 5 86,182,820 - 86,351,488 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 5 88,000,151 - 88,168,819 (-) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 5 87,975,837 - 88,144,496 (-) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 5 86,387,238 - 86,554,108 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl 5 86,387,078 - 86,554,102 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 RGSC_v3.4 5 87,564,010 - 87,738,257 (-) NCBI RGSC3.4 RGSC_v3.4 rn4 RGSC3.4 RGSC_v3.1 5 87,569,157 - 87,585,659 (-) NCBI Celera 5 82,598,401 - 82,765,611 (-) NCBI Celera Cytogenetic Map 5 q31 NCBI
CDK5RAP2 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 9 120,388,875 - 120,580,167 (-) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl 9 120,388,875 - 120,580,170 (-) Ensembl GRCh38 hg38 GRCh38 GRCh37 9 123,151,153 - 123,342,445 (-) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 9 122,190,968 - 122,382,258 (-) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 9 120,230,701 - 120,421,991 NCBI Celera 9 93,799,407 - 93,990,706 (-) NCBI Celera Cytogenetic Map 9 q33.2 NCBI HuRef 9 92,769,151 - 92,960,484 (-) NCBI HuRef CHM1_1 9 123,298,715 - 123,489,623 (-) NCBI CHM1_1 T2T-CHM13v2.0 9 132,583,189 - 132,774,493 (-) NCBI T2T-CHM13v2.0
Cdk5rap2 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 4 70,135,092 - 70,328,672 (-) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl 4 70,135,093 - 70,328,680 (-) Ensembl GRCm39 Ensembl GRCm38 4 70,216,855 - 70,410,435 (-) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl 4 70,216,856 - 70,410,443 (-) Ensembl GRCm38 mm10 GRCm38 MGSCv37 4 69,884,058 - 70,071,401 (-) NCBI GRCm37 MGSCv37 mm9 NCBIm37 MGSCv36 4 69,709,385 - 69,896,728 (-) NCBI MGSCv36 mm8 Celera 4 68,823,988 - 69,004,683 (-) NCBI Celera Cytogenetic Map 4 C2 NCBI
Cdk5rap2 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955419 7,412,331 - 7,610,353 (+) Ensembl ChiLan1.0 ChiLan1.0 NW_004955419 7,412,177 - 7,606,883 (+) NCBI ChiLan1.0 ChiLan1.0
CDK5RAP2 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 11 18,765,717 - 18,953,897 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 9 18,768,068 - 18,956,572 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 9 91,519,179 - 91,707,469 (-) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 9 119,867,654 - 120,055,608 (-) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl 9 119,868,015 - 120,055,608 (-) Ensembl panpan1.1 panPan2
CDK5RAP2 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 11 73,548,003 - 73,693,044 (-) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl 11 73,548,038 - 73,690,199 (-) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha 11 71,961,518 - 72,114,600 (-) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 11 74,680,442 - 74,834,175 (-) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl 11 74,680,482 - 74,823,995 (-) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 11 73,193,623 - 73,346,570 (-) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 11 73,225,707 - 73,378,608 (-) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 11 73,962,635 - 74,115,691 (-) NCBI UU_Cfam_GSD_1.0
Cdk5rap2 Squirrel Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl HiC_Itri_2 NW_024404947 189,132,141 - 189,313,032 (-) NCBI HiC_Itri_2 SpeTri2.0 Ensembl NW_004936487 8,900,530 - 9,081,527 (-) Ensembl SpeTri2.0 SpeTri2.0 Ensembl SpeTri2.0 NW_004936487 8,900,375 - 9,081,547 (-) NCBI SpeTri2.0 SpeTri2.0 SpeTri2.0
CDK5RAP2 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl 1 260,466,942 - 260,648,161 (-) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 1 260,465,809 - 260,648,070 (-) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 1 292,619,819 - 292,719,239 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
CDK5RAP2 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 12 18,999,203 - 19,186,801 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl 12 18,999,213 - 19,186,785 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666035 23,820,723 - 24,007,238 (-) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Cdk5rap2
.
Predicted Target Of
Count of predictions: 215 Count of miRNA genes: 169 Interacting mature miRNAs: 189 Transcripts: ENSRNOT00000007710 Prediction methods: Microtar, Rnahybrid, Targetscan Result types: miRGate_prediction
1300115 Hrtrt7 Heart rate QTL 7 2.76 heart pumping trait (VT:2000009) heart rate (CMO:0000002) 5 47869062 90099692 Rat 1357396 Bw44 Body weight QTL 44 4.19 body mass (VT:0001259) body weight (CMO:0000012) 5 68984307 104251008 Rat 1549845 Scl44 Serum cholesterol level QTL 44 6 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 40128307 148607290 Rat 61380 Edpm5 Estrogen-dependent pituitary mass QTL 5 4.5 0.92 pituitary gland mass (VT:0010496) pituitary gland wet weight (CMO:0000853) 5 68984307 104251008 Rat 70212 Niddm25 Non-insulin dependent diabetes mellitus QTL 25 3.54 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 1 131345958 Rat 1298070 Scl18 Serum cholesterol level QTL 18 3.7 blood LDL cholesterol amount (VT:0000181) calculated plasma low density lipoprotein cholesterol level (CMO:0001245) 5 79584860 124584860 Rat 634305 Mamtr1 Mammary tumor resistance QTL 1 0.0001 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 12789751 113558310 Rat 61386 Bp49 Blood pressure QTL 49 16.6 cerebrum integrity trait (VT:0010549) brain infarction volume (CMO:0001013) 5 60293434 98603051 Rat 1331801 Rf33 Renal function QTL 33 4.149 kidney blood vessel physiology trait (VT:0100012) absolute change in renal vascular resistance (CMO:0001900) 5 43726656 129132602 Rat 1357402 Bw46 Body weight QTL 46 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 2302381 Bw84 Body weight QTL 84 4.47 body mass (VT:0001259) body mass index (BMI) (CMO:0000105) 5 68984307 104251008 Rat 61393 Bp7 Blood pressure QTL 7 4.5 0.0001 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 60293434 161481680 Rat 1331782 Rf36 Renal function QTL 36 3.296 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 83840598 97059958 Rat 1598859 Cm66 Cardiac mass QTL 66 2 heart mass (VT:0007028) heart weight to body weight ratio (CMO:0000074) 5 79584860 124584860 Rat 1302790 Scl20 Serum cholesterol level QTL 20 6.4 0.0001 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 82394392 166664054 Rat 1578766 Tcas11 Tongue tumor susceptibility QTL 11 4.12 tongue integrity trait (VT:0010553) number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950) 5 46711509 161317411 Rat 7411561 Bw134 Body weight QTL 134 24 0.001 body mass (VT:0001259) body weight gain (CMO:0000420) 5 49463600 94463600 Rat 2303615 Vencon7 Ventilatory control QTL 7 0.001 respiration trait (VT:0001943) respiration rate (CMO:0000289) 5 50983895 95983895 Rat 1576312 Emca8 Estrogen-induced mammary cancer QTL 8 4.1 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 50328551 141643988 Rat 1641912 Alcrsp18 Alcohol response QTL 18 response to alcohol trait (VT:0010489) duration of loss of righting reflex (CMO:0002289) 5 35189153 141643988 Rat 1576314 Eutr1 Estrogen induced uterine response QTL 1 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 2138965 166875058 Rat 1576317 Eutr2 Estrogen induced uterine response QTL 2 0.01 uterus integrity trait (VT:0010575) pyometritis severity score (CMO:0002009) 5 34730116 104251008 Rat 1598846 Bp293 Blood pressure QTL 293 3.9 arterial blood pressure trait (VT:2000000) systolic blood pressure (CMO:0000004) 5 79584860 124584860 Rat 7394712 Emca13 Estrogen-induced mammary cancer QTL 13 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 9823266 99753708 Rat 1331773 Scl26 Serum cholesterol level QTL 26 3.065 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 43726656 86724018 Rat 70189 Mcs5 Mammary carcinoma susceptibility QTL 5 10.51 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 55805606 132207589 Rat 1331771 Rf35 Renal function QTL 35 4.36965 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 729470 86724018 Rat 61359 Eaex Experimental allergic encephalomyelitis QTL x 3 nervous system integrity trait (VT:0010566) post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422) 5 55715622 100715622 Rat 2290448 Scl54 Serum cholesterol level QTL 54 2.93 blood cholesterol amount (VT:0000180) plasma total cholesterol level (CMO:0000585) 5 31663789 131345958 Rat 61426 Scl2 Serum cholesterol level QTL 2 7.3 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 59793399 143070159 Rat 1354598 Srn6 Serum renin concentration QTL 6 3.8 blood renin amount (VT:0003349) plasma renin activity level (CMO:0000116) 5 69540295 151018848 Rat 9589025 Epfw7 Epididymal fat weight QTL 7 20.66 0.001 epididymal fat pad mass (VT:0010421) epididymal fat pad weight to body weight ratio (CMO:0000658) 5 49463600 94463600 Rat 2303574 Gluco42 Glucose level QTL 42 2 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 53496719 98496719 Rat 2290005 Mcs24 Mammary carcinoma susceptibility QTL 24 mammary gland integrity trait (VT:0010552) mammary tumor number (CMO:0000343) 5 64719390 109719390 Rat 1331756 Rf34 Renal function QTL 34 4.16275 kidney blood vessel physiology trait (VT:0100012) absolute change in renal blood flow rate (CMO:0001168) 5 1 90450412 Rat 2306971 Anxrr21 Anxiety related response QTL 21 9.47 fear/anxiety-related behavior trait (VT:1000241) number of entries into a discrete space in an experimental apparatus (CMO:0000960) 5 66174080 124160948 Rat 2316954 Rf57 Renal function QTL 57 0 kidney glomerulus morphology trait (VT:0005325) index of glomerular damage (CMO:0001135) 5 59793528 90450144 Rat 1358895 Bp254 Blood pressure QTL 254 3.6 0.0003 arterial blood pressure trait (VT:2000000) mean arterial blood pressure (CMO:0000009) 5 58829236 128034027 Rat 2316959 Gluco59 Glucose level QTL 59 4.7 blood glucose amount (VT:0000188) blood glucose level (CMO:0000046) 5 34944474 113558310 Rat 2312671 Scl64 Serum cholesterol level QTL 64 0.001 blood cholesterol amount (VT:0000180) serum total cholesterol level (CMO:0000363) 5 68984307 104251008 Rat 2316957 Pur21 Proteinuria QTL 21 6.2 urine protein amount (VT:0005160) urine protein level (CMO:0000591) 5 59793528 113558156 Rat
RH104241
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 83,912,064 - 83,912,200 (+) MAPPER mRatBN7.2 Rnor_6.0 5 86,505,863 - 86,505,998 NCBI Rnor6.0 Rnor_5.0 5 90,593,083 - 90,593,218 UniSTS Rnor5.0 RGSC_v3.4 5 87,684,740 - 87,684,875 UniSTS RGSC3.4 Celera 5 82,718,075 - 82,718,210 UniSTS Cytogenetic Map 5 q31 UniSTS
RH130294
Rat Assembly Chr Position (strand) Source JBrowse mRatBN7.2 5 83,959,417 - 83,959,598 (+) MAPPER mRatBN7.2 Rnor_6.0 5 86,552,738 - 86,552,918 NCBI Rnor6.0 Rnor_5.0 5 90,639,958 - 90,640,138 UniSTS Rnor5.0 RGSC_v3.4 5 87,736,977 - 87,737,157 UniSTS RGSC3.4 Celera 5 82,764,247 - 82,764,427 UniSTS RH 3.4 Map 5 656.1 UniSTS Cytogenetic Map 5 q31 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000007710 ⟹ ENSRNOP00000007710
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 83,792,284 - 83,960,782 (-) Ensembl Rnor_6.0 Ensembl 5 86,387,240 - 86,554,102 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000083340 ⟹ ENSRNOP00000073851
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 83,796,812 - 83,960,782 (-) Ensembl Rnor_6.0 Ensembl 5 86,387,078 - 86,554,102 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095333 ⟹ ENSRNOP00000086335
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 83,796,812 - 83,960,782 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000095599 ⟹ ENSRNOP00000086004
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 83,796,812 - 83,960,782 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000118617 ⟹ ENSRNOP00000096134
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source mRatBN7.2 Ensembl 5 83,796,812 - 83,960,782 (-) Ensembl
RefSeq Acc Id:
NM_173134 ⟹ NP_775157
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,975,897 (-) NCBI mRatBN7.2 5 83,792,284 - 83,960,782 (-) NCBI Rnor_6.0 5 86,387,240 - 86,554,102 (-) NCBI Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI Celera 5 82,598,401 - 82,765,611 (-) NCBI
Sequence:
GATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTGGGTTGGAGGGGGCGGGACCTGGGGAACCGAGCGCGCCGCGACTGCGGGGTAACCAGTGGCGCTGCTGCTG
hide sequence
RefSeq Acc Id:
XM_006238273 ⟹ XP_006238335
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,125 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,108 (-) NCBI Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI
Sequence:
GGGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTG
hide sequence
RefSeq Acc Id:
XM_006238274 ⟹ XP_006238336
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,120 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,108 (-) NCBI Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI
Sequence:
GGGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTGGGTTGGAGGGGGCGGGACCTGGGGAACCGAGCGCGCCGCGACTGCGGGGTAACCAGTGGCGCTG
hide sequence
RefSeq Acc Id:
XM_006238276 ⟹ XP_006238338
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,118 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,108 (-) NCBI Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI
Sequence:
GGGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTG
hide sequence
RefSeq Acc Id:
XM_006238277 ⟹ XP_006238339
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,116 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,107 (-) NCBI Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI
Sequence:
GGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTGGGTTGGAGGGGGCGGGACCTGGGGAACCGAGCGCGCCGCGACTGCGGGGTAACCAGTGGCGCTGC
hide sequence
RefSeq Acc Id:
XM_006238278 ⟹ XP_006238340
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,117 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,107 (-) NCBI Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI
Sequence:
GGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTGG
hide sequence
RefSeq Acc Id:
XM_006238279 ⟹ XP_006238341
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,032 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,107 (-) NCBI Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI
Sequence:
GGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTGGGTTGGAGGGGGCGGGACCTGGGGAACCGAGCGCGCCGCGACTGCGGGGTAACCAGTGGCGCTGC
hide sequence
RefSeq Acc Id:
XM_006238280 ⟹ XP_006238342
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,120 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,108 (-) NCBI Rnor_5.0 5 90,474,206 - 90,641,334 (-) NCBI
Sequence:
GGGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTG
hide sequence
RefSeq Acc Id:
XM_008763760 ⟹ XP_008761982
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,127 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,108 (-) NCBI
Sequence:
GGGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTG
hide sequence
RefSeq Acc Id:
XM_017593184 ⟹ XP_017448673
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,129 (-) NCBI Rnor_6.0 5 86,387,238 - 86,554,108 (-) NCBI
Sequence:
GGGAAAGATGGCGGCGGCTGCGGTTTGAATTCCAGCGGCGCCGCTTGACTGAGAACAAGAGCTGGGTTGGAGGGGGCGGGACCTGGGGAACCGAGCGCGCCGCGACTGCGGGGTAACCAGTGGCGCTG
hide sequence
RefSeq Acc Id:
XM_039109346 ⟹ XP_038965274
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,969,137 (-) NCBI mRatBN7.2 5 83,792,282 - 83,954,045 (-) NCBI
RefSeq Acc Id:
XM_039109347 ⟹ XP_038965275
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI mRatBN7.2 5 83,792,282 - 83,961,117 (-) NCBI
RefSeq Acc Id:
XM_063287220 ⟹ XP_063143290
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI
RefSeq Acc Id:
XM_063287222 ⟹ XP_063143292
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI
RefSeq Acc Id:
XM_063287223 ⟹ XP_063143293
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI
RefSeq Acc Id:
XM_063287224 ⟹ XP_063143294
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 5 88,807,402 - 88,976,005 (-) NCBI
RefSeq Acc Id:
NP_775157 ⟸ NM_173134
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot), F1M4B7 (UniProtKB/TrEMBL)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKKNIELKVEVESLKRELQERDQLLVKAS
hide sequence
RefSeq Acc Id:
XP_006238336 ⟸ XM_006238274
- Peptide Label:
isoform X2
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFE
hide sequence
RefSeq Acc Id:
XP_006238342 ⟸ XM_006238280
- Peptide Label:
isoform X13
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFE
hide sequence
RefSeq Acc Id:
XP_006238335 ⟸ XM_006238273
- Peptide Label:
isoform X1
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKKNIELKVEVESLKRELQERDQLLVKAS
hide sequence
RefSeq Acc Id:
XP_006238339 ⟸ XM_006238277
- Peptide Label:
isoform X6
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKKNIELKVEVESLKRELQERDQLLVKAS
hide sequence
RefSeq Acc Id:
XP_006238338 ⟸ XM_006238276
- Peptide Label:
isoform X5
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKKNIELKVEVESLKRELQERDQLLVKAS
hide sequence
RefSeq Acc Id:
XP_006238341 ⟸ XM_006238279
- Peptide Label:
isoform X11
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKKNIELKVEVESLKRELQERDQLLVKAS
hide sequence
RefSeq Acc Id:
XP_006238340 ⟸ XM_006238278
- Peptide Label:
isoform X10
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFE
hide sequence
RefSeq Acc Id:
XP_008761982 ⟸ XM_008763760
- Peptide Label:
isoform X3
- UniProtKB:
A0A0G2K6K7 (UniProtKB/TrEMBL)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKKNIELKVEVESLKRELQERDQLLVKAS
hide sequence
RefSeq Acc Id:
XP_017448673 ⟸ XM_017593184
- Peptide Label:
isoform X4
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
- Sequence:
MMDSGMEEDVTLPGTLSGCSGLHPVLPSDLDVISDTTGLGNGVLPIMSEEKVSPTRARNMKDFENQITELKKENFNLKLRIYFLEERIQQEFAGPTEHIYKKNIELKVEVESLKRELQERDQLLVKAS
hide sequence
Ensembl Acc Id:
ENSRNOP00000007710 ⟸ ENSRNOT00000007710
Ensembl Acc Id:
ENSRNOP00000073851 ⟸ ENSRNOT00000083340
RefSeq Acc Id:
XP_038965275 ⟸ XM_039109347
- Peptide Label:
isoform X9
- UniProtKB:
A0A3G1T2C5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_038965274 ⟸ XM_039109346
- Peptide Label:
isoform X7
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
Ensembl Acc Id:
ENSRNOP00000086335 ⟸ ENSRNOT00000095333
Ensembl Acc Id:
ENSRNOP00000096134 ⟸ ENSRNOT00000118617
Ensembl Acc Id:
ENSRNOP00000086004 ⟸ ENSRNOT00000095599
RefSeq Acc Id:
XP_063143290 ⟸ XM_063287220
- Peptide Label:
isoform X8
- UniProtKB:
A0A3G1T2C5 (UniProtKB/TrEMBL)
RefSeq Acc Id:
XP_063143294 ⟸ XM_063287224
- Peptide Label:
isoform X15
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143293 ⟸ XM_063287223
- Peptide Label:
isoform X14
- UniProtKB:
Q9JLH5 (UniProtKB/Swiss-Prot), K7QQW0 (UniProtKB/Swiss-Prot)
RefSeq Acc Id:
XP_063143292 ⟸ XM_063287222
- Peptide Label:
isoform X12
- UniProtKB:
A0A8I6AL63 (UniProtKB/TrEMBL)
RGD ID: 13693809 Promoter ID: EPDNEW_R4334 Type: multiple initiation site Name: Cdk5rap2_1 Description: CDK5 regulatory subunit associated protein 2 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 5 86,554,106 - 86,554,166 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2006-03-30
Cdk5rap2
CDK5 regulatory subunit associated protein 2
CDK5 activator-binding protein
Name updated
1299863 APPROVED
2004-09-10
Cdk5rap2
CDK5 activator-binding protein
LOC286919
Symbol and Name updated
1299863 APPROVED
Note Type
Note
Reference
gene_physical_interaction
interacts with p35nck5a complexed with Cdk5
632478
