Advanced Search (OLGA)

Gene: Gnl3 (G protein nucleolar 3) Rattus norvegicus

Analyze

Symbol:

Gnl3

Name:

G protein nucleolar 3

RGD ID:

631354

Description:

Enables GTP binding activity. Involved in regulation of cell population proliferation. Located in nucleolus. Orthologous to human GNL3 (G protein nucleolar 3); PARTICIPATES IN ribosome biogenesis pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

guanine nucleotide binding protein-like 3 (nucleolar); guanine nucleotide-binding protein-like 3; Ns; nucleolar GTP-binding protein 3; nucleostemin

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GNL3 (G protein nucleolar 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gnl3 (guanine nucleotide binding protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gnl3 (G protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GNL3 (G protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GNL3 (G protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gnl3 (G protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GNL3 (G protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GNL3 (G protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gnl3 (G protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Gnl3 (G protein nucleolar 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Gnl3 (guanine nucleotide binding protein nucleolar 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	GNL3 (G protein nucleolar 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gnl3 (guanine nucleotide binding protein-like 3 (nucleolar))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	NUG1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	NUG1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Ns1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	nst-1	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	gnl3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Gnl3-ps1

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	6,213,844 - 6,220,029 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	6,213,871 - 6,219,845 (-)	Ensembl				GRCr8
mRatBN7.2	16	6,207,402 - 6,213,491 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	6,207,402 - 6,213,392 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	6,219,249 - 6,225,194 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	7,364,713 - 7,370,658 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	6,226,411 - 6,232,353 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	7,097,580 - 7,103,518 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	7,097,507 - 7,103,604 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	7,026,164 - 7,032,102 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	6,444,437 - 6,450,375 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	8,975,971 - 8,981,909 (+)	NCBI		Celera
RGSC_v3.1	16	6,444,434 - 6,450,373 (-)	NCBI
Cytogenetic Map	16	p16	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-alpha-phellandrene (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

4-tert-Octylphenol (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-phellandrene (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beta-naphthoflavone (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

bisphenol F (ISO)

Butylbenzyl phthalate (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

carnosic acid (ISO)

CGP 52608 (ISO)

chromium(6+) (ISO)

clofibrate (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

cyclosporin A (ISO)

DDE (ISO)

deoxynivalenol (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

diethylstilbestrol (EXP,ISO)

dioxygen (ISO)

diquat (ISO)

diuron (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fluoranthene (ISO)

flutamide (EXP)

formaldehyde (ISO)

gentamycin (EXP)

glutathione (EXP)

hydrogen peroxide (ISO)

inulin (ISO)

ivermectin (ISO)

ketoconazole (ISO)

methyl methanesulfonate (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

Nivalenol (ISO)

okadaic acid (ISO)

ozone (ISO)

p-tert-Amylphenol (EXP)

paracetamol (ISO)

paraquat (EXP)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (ISO)

phorone (EXP)

pirinixic acid (EXP,ISO)

potassium chromate (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

rotenone (ISO)

SB 431542 (ISO)

sevoflurane (EXP)

sodium arsenite (ISO)

sodium dichromate (EXP)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trimellitic anhydride (ISO)

trovafloxacin (EXP)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of miRNA transcription (IEA,ISO)

positive regulation of protein localization to chromosome, telomeric region (IEA,ISO)

positive regulation of protein sumoylation (IEA,ISO)

positive regulation of telomere maintenance (IEA,ISO)

regulation of cell population proliferation (IMP)

stem cell division (IEA,ISO)

stem cell population maintenance (IEA,ISO)

Cellular Component

chromosome (IEA,ISO)

nuclear body (IEA,ISO)

nucleolus (IBA,IDA,IEA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IDA,IEA)

Molecular Function

GTP binding (IEA,IMP,ISO)

mRNA 5'-UTR binding (IEA,ISO)

nucleotide binding (IEA)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
7.	A nucleolar mechanism controlling cell proliferation in stem cells and cancer cells.	Tsai RY and McKay RD, Genes Dev 2002 Dec 1;16(23):2991-3003.
8.	A multistep, GTP-driven mechanism controlling the dynamic cycling of nucleostemin.	Tsai RY and McKay RD, J Cell Biol. 2005 Jan 17;168(2):179-84.

Additional References at PubMed

PMID:15857956	PMID:16139428	PMID:16213212	PMID:17158916	PMID:18211284	PMID:18519946	PMID:19946888	PMID:22641345	PMID:22658674	PMID:22664934	PMID:22681889	PMID:25522312
PMID:25569094	PMID:26138242	PMID:34785448

Genomics

Comparative Map Data

Gnl3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	16	6,213,844 - 6,220,029 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	16	6,213,871 - 6,219,845 (-)	Ensembl				GRCr8
mRatBN7.2	16	6,207,402 - 6,213,491 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	16	6,207,402 - 6,213,392 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	16	6,219,249 - 6,225,194 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	16	7,364,713 - 7,370,658 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	16	6,226,411 - 6,232,353 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	16	7,097,580 - 7,103,518 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	16	7,097,507 - 7,103,604 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	16	7,026,164 - 7,032,102 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	16	6,444,437 - 6,450,375 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	16	8,975,971 - 8,981,909 (+)	NCBI		Celera
RGSC_v3.1	16	6,444,434 - 6,450,373 (-)	NCBI
Cytogenetic Map	16	p16	NCBI

GNL3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	52,685,920 - 52,694,497 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	52,681,156 - 52,696,160 (+)	Ensembl			hg38	GRCh38
GRCh37	3	52,719,936 - 52,728,513 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	52,694,976 - 52,703,553 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	3	52,698,648 - 52,707,224 (+)	NCBI		Celera
Cytogenetic Map	3	p21.1	NCBI
HuRef	3	52,781,776 - 52,790,367 (+)	NCBI		HuRef
CHM1_1	3	52,672,005 - 52,680,589 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	52,718,831 - 52,727,408 (+)	NCBI		T2T-CHM13v2.0

Gnl3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	30,734,390 - 30,741,088 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	30,734,390 - 30,741,109 (-)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	14	31,012,433 - 31,019,131 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	31,012,433 - 31,019,152 (-)	Ensembl			mm10	GRCm38
MGSCv37	14	31,825,619 - 31,832,275 (-)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	14	29,841,442 - 29,848,070 (-)	NCBI		MGSCv36	mm8
Celera	14	27,270,250 - 27,276,906 (-)	NCBI		Celera
Cytogenetic Map	14	B	NCBI
cM Map	14	19.09	NCBI

Gnl3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955430	2,675,477 - 2,678,113 (+)	NCBI	ChiLan1.0	ChiLan1.0

GNL3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	2	52,679,394 - 52,688,116 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	3	52,684,359 - 52,694,543 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	52,626,424 - 52,635,009 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	53,854,257 - 53,862,823 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	53,854,257 - 53,862,818 (+)	Ensembl			panPan2	panpan1.1

GNL3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	37,103,298 - 37,110,350 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	37,103,320 - 37,110,207 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	37,085,316 - 37,092,373 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	37,454,085 - 37,461,144 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	37,453,398 - 37,461,079 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	36,817,632 - 36,824,634 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	37,226,252 - 37,233,270 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	37,503,889 - 37,510,799 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Gnl3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	170,337,889 - 170,345,199 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936473	3,476,392 - 3,483,615 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936473	3,476,436 - 3,483,868 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GNL3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	34,814,901 - 34,828,517 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	13	34,820,243 - 34,828,523 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	38,020,526 - 38,028,557 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GNL3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	14,059,191 - 14,068,388 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	22	14,059,204 - 14,068,155 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666041	152,831,706 - 152,840,905 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gnl3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624822	4,519,324 - 4,528,802 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624822	4,519,172 - 4,529,241 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Gnl3
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	13	6,712,985 - 6,719,437 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Gnl3
8 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	17
Count of miRNA genes:	15
Interacting mature miRNAs:	15
Transcripts:	ENSRNOT00000033677
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582235	Insul8	Insulin level QTL 8	3.3	0.0063	blood insulin amount (VT:0001560)	calculated serum insulin level (CMO:0000359)	16	4234212	16278352	Rat
1549842	Bp248	Blood pressure QTL 248		0.01	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	387123	45387123	Rat
2307172	Activ4	Activity QTL 4	3.71	0.00023	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	16	1	33425095	Rat
1354584	Despr6	Despair related QTL 6	3.1	0.0067	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	1	39568015	Rat
737819	Hcas4	Hepatocarcinoma susceptibility QTL 4	4.43		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	16	4234212	53708481	Rat
1354625	Despr7	Despair related QTL 7	3.16	0.016	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	16	4744222	49744222	Rat
61338	Bp23	Blood pressure QTL 23	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	4234212	16278352	Rat
61405	Niddm6	Non-insulin dependent diabetes mellitus QTL 6	3.66	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	16	1	26734272	Rat
631830	Alc7	Alcohol consumption QTL 7	2.9		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	1	26734272	Rat
7411664	Foco30	Food consumption QTL 30	11	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	16	4354822	49354822	Rat
1600378	Arunc4	Aerobic running capacity QTL 4		0.03	exercise endurance trait (VT:0002332)	longest distance run on treadmill (CMO:0001406)	16	387123	45387123	Rat
70183	BpQTLcluster13	Blood pressure QTL cluster 13	3.654		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	4234212	49757901	Rat
737826	Alc11	Alcohol consumption QTL 11	3.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4234212	66955197	Rat
737825	Alc13	Alcohol consumption QTL 13	4.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	16	4234212	16061395	Rat
2303566	Bw90	Body weight QTL 90	2		body mass (VT:0001259)	body weight (CMO:0000012)	16	1	39568015	Rat
631524	Bp75	Blood pressure QTL 75		0.05	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	16	117710	8157035	Rat
2312663	Slep9	Serum leptin concentration QTL 9		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	16	839086	66195506	Rat
2306902	Bp339	Blood pressure QTL 339		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	16	3386790	49757901	Rat
1300133	Rf24	Renal function QTL 24	3.64		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	16	3386790	26128267	Rat
2312660	Bw95	Body weight QTL 95		0.05	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	16	839086	66195506	Rat
2312666	Insul16	Insulin level QTL 16		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	16	839086	66195506	Rat
634355	Rends4	Renal damage susceptibility QTL 4		0.05	kidney blood vessel morphology trait (VT:0000530)	organ lesion measurement (CMO:0000677)	16	1	26734272	Rat
61372	Bp40	Blood pressure QTL 40	2.2		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	16	4234333	17730812	Rat
2293343	Glom16	Glomerulus QTL 16	7.4		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	16	839086	52786090	Rat
2312669	Stl23	Serum triglyceride level QTL 23		0.01	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	16	839086	66195506	Rat
6903319	Bw114	Body weight QTL 114	2.7	0.0037	body mass (VT:0001259)	body weight (CMO:0000012)	16	3301683	48301683	Rat

Markers in Region

RH143485

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	16	6,209,352 - 6,209,550 (+)	MAPPER	mRatBN7.2
Rnor_6.0	16	7,099,531 - 7,099,728	NCBI	Rnor6.0
Rnor_5.0	16	7,028,115 - 7,028,312	UniSTS	Rnor5.0
RGSC_v3.4	16	6,446,388 - 6,446,585	UniSTS	RGSC3.4
Celera	16	8,979,761 - 8,979,958	UniSTS
RH 3.4 Map	16	44.7	UniSTS
Cytogenetic Map	16	p16	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_175580	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063275134	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121615	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY181024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC072500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC093602	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474046	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228449	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229528	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000033677 ⟹ ENSRNOP00000035860

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	16	6,213,871 - 6,219,845 (-)	Ensembl
mRatBN7.2 Ensembl	16	6,207,402 - 6,213,392 (-)	Ensembl
Rnor_6.0 Ensembl	16	7,097,507 - 7,103,604 (-)	Ensembl

RefSeq Acc Id:

NM_175580 ⟹ NP_783170

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	6,213,844 - 6,219,782 (-)	NCBI
mRatBN7.2	16	6,207,402 - 6,213,340 (-)	NCBI
Rnor_6.0	16	7,097,580 - 7,103,518 (-)	NCBI
Rnor_5.0	16	7,026,164 - 7,032,102 (-)	NCBI
RGSC_v3.4	16	6,444,437 - 6,450,375 (-)	RGD
Celera	16	8,975,971 - 8,981,909 (+)	RGD

Sequence:

show sequence

GCGGCCGAGGTACCTGAGACCTCTTCTGCTCCAGACGCGTCCGCGGCCAGGATGAAGAGGCCGA
AGTTAAAGAAAGCAAGTAAACGTATGACCTGTCATAAGCGGTATAAAATCCAGAAAAAGGTTCG
AGAACATCATCGAAAATTAAGGAAGGAAGCTAAAAAGCGGGGTCACAAGAAGCCTAAGAAGGAC
CCAGGAGTTCCAAATAGTGCTCCCTTTAAAGAGGCTCTTCTTCGTGAAGCTGAGCTAAGGAAAC
AGCAGCTTGAAGAACTAAAACAGCAGCAGAAACTTGACAGGCAAAAAGAACAAGAACGAAAAAG
AAAACTTGAAATTAGCCCTGATGATGAGCAATCTAATGTGGAAACTCAGGAGGAATCTGATGAG
CCCAAAATAAAGAAAGCTAAATCAGGCAAACAGAATCCAAAGAAGTTACATTGTCAGGAACTTA
AAAAGGTGATTGAAGCCTCAGACATTGTGTTAGAAGTTTTGGATGCCAGAGATCCTCTTGGTTG
CAGGTGTCCTCAAGTAGAAGAAGCTGTTATCCAAAGTGGATGTAAAAAACTAGTACTTGTATTA
AATAAGTCAGATCTAGTACCAAAAGAGAATCTAGAGAACTGGCTAACTTACTTGAATAAGGAAT
TGCCAACAGTGGTGTTCAAAGCCTCAACAAACTTAAAGAACAGAAAGAAGACATTCAAGATAAA
GAAGAAAGTTGTTCCATTCCAAAGTAAACTCTGCTGTGGCAAGGAAGCACTGTGGAAGCTCCTT
GGAGGTTTTCAGCAGTCCTGTGGAAAAGGAGTTCAGGTTGGAGTGGTTGGTTTCCCAAATGTGG
GAAAAAGCAGCATCATTAATAGTTTAAAACAAGAAAGGATTTGCAGTGTTGGAGTTTCCATGGG
ACTTACAAGGAGTATGCAGATTGTCCCTTTAGACAAACAGATCACAATCATAGATAGTCCGTGC
TTCATTATCTCACCTTGTAACTCCCCTGCTGCACTTGCCCTCCGAAGTCCAGCAAGTATTGAAG
TTCTAAGACCATTGGAGGCTGCCAGTGCCATCCTGTCTCAGGCTGATAGTCAACAGGTGGTGTT
AAAATATACTGTCCCGGGGTATAAGGATTCTCTGGATTTTTTTACTAAACTTGCTCAGAGAAGA
GGTCTGCACCAAAAAGGTGGAAGCCCAAATGTCGAAAGTGCTGCTAAGCTGCTATGGTCTGAGT
GGACAGGTGCCTCATTAGGTTACTACTGCCATCCCCCTGCATCCTGGAATCATTCTCCTCATTT
TAATGAGAATATTACAGCAATCATGAAGAGGGGCTTTAATCTAGAAGAACTAGAAAAGAATAAT
GCACACAGCATACAAGTCCTCAAGGGCCCTCATTTAACTAATAAAATCCTTTTCCGGTCTTCGG
GCCTGACAAATGGAATACTAGAAGAAAAGGACATCCCCGAAGAGTCACCAAAACAGACAGAAGA
CCAACAGGATGGTGATGATCAAGAACATGTTACTGGTGAAAAAAATGCAGAGATCTCAGATGTG
ACTCCTGTAGAAGAGACCAGGGAGATGTCACCTGGGCAATCAACAGCAAGTAAACCATCTGACA
GATCCTTTATCTTGGATAAAATGAGTGAAGAAGACGATGCCTATGACTTTACCACAGATTATAT
ATAGCCTTCTAAATGTTCAAGTGTGCTCTGTACAGTGTTTNTAGATTGCTTTGGTATGATATAA
AGTGTAAATCTTGTGAATATGTATCATGTTTTAAATTAAAAACAAAATAAAAAGTGTTTGTATA
AAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_063275134 ⟹ XP_063131204

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	16	6,214,689 - 6,220,029 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_783170	(Get FASTA)	NCBI Sequence Viewer
	XP_063131204	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH93602	(Get FASTA)	NCBI Sequence Viewer
	AAO19471	(Get FASTA)	NCBI Sequence Viewer
	EDL88967	(Get FASTA)	NCBI Sequence Viewer
	EDL88968	(Get FASTA)	NCBI Sequence Viewer
	EDL88969	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000035860
	ENSRNOP00000035860.3
GenBank Protein	Q811S9	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_783170 ⟸ NM_175580

- UniProtKB:

Q566E0 (UniProtKB/Swiss-Prot), Q811S9 (UniProtKB/Swiss-Prot), A6KG10 (UniProtKB/TrEMBL), A6KG11 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MKRPKLKKASKRMTCHKRYKIQKKVREHHRKLRKEAKKRGHKKPKKDPGVPNSAPFKEALLREA
ELRKQQLEELKQQQKLDRQKEQERKRKLEISPDDEQSNVETQEESDEPKIKKAKSGKQNPKKLH
CQELKKVIEASDIVLEVLDARDPLGCRCPQVEEAVIQSGCKKLVLVLNKSDLVPKENLENWLTY
LNKELPTVVFKASTNLKNRKKTFKIKKKVVPFQSKLCCGKEALWKLLGGFQQSCGKGVQVGVVG
FPNVGKSSIINSLKQERICSVGVSMGLTRSMQIVPLDKQITIIDSPCFIISPCNSPAALALRSP
ASIEVLRPLEAASAILSQADSQQVVLKYTVPGYKDSLDFFTKLAQRRGLHQKGGSPNVESAAKL
LWSEWTGASLGYYCHPPASWNHSPHFNENITAIMKRGFNLEELEKNNAHSIQVLKGPHLTNKIL
FRSSGLTNGILEEKDIPEESPKQTEDQQDGDDQEHVTGEKNAEISDVTPVEETREMSPGQSTAS
KPSDRSFILDKMSEEDDAYDFTTDYI

hide sequence

Ensembl Acc Id:

ENSRNOP00000035860 ⟸ ENSRNOT00000033677

RefSeq Acc Id:	XP_063131204 ⟸ XM_063275134
- Peptide Label:	isoform X1
- UniProtKB:	A6KG11 (UniProtKB/TrEMBL)

Protein Domains

CP-type G

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q811S9-F1-model_v2	AlphaFold	Q811S9	1-538	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699922

Promoter ID:

EPDNEW_R10445

Type:

initiation region

Name:

Gnl3_1

Description:

G protein nucleolar 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	16	7,103,549 - 7,103,609	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:631354	AgrOrtholog
BioCyc Gene	G2FUF-12170	BioCyc
Ensembl Genes	ENSRNOG00000028461	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000033677	ENTREZGENE
	ENSRNOT00000033677.6	UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.1580.10	UniProtKB/Swiss-Prot
	3.40.50.300	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7099304	IMAGE-MGC_LOAD
	IMAGE:7316170	IMAGE-MGC_LOAD
InterPro	G_CP_dom	UniProtKB/Swiss-Prot
	Gnl3_N_dom	UniProtKB/Swiss-Prot
	GTP-bd_ortho_bundle_sf	UniProtKB/Swiss-Prot
	GTP_binding_domain	UniProtKB/Swiss-Prot
	P-loop_NTPase	UniProtKB/Swiss-Prot
	TRAFAC_YlqF/YawG_RiboMat	UniProtKB/Swiss-Prot
KEGG Report	rno:290556	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105287	IMAGE-MGC_LOAD
	MGC:91414	IMAGE-MGC_LOAD
NCBI Gene	290556	ENTREZGENE
PANTHER	GTP-BINDING PROTEIN-RELATED	UniProtKB/Swiss-Prot
	GUANINE NUCLEOTIDE-BINDING PROTEIN-LIKE 3	UniProtKB/Swiss-Prot
Pfam	GN3L_Grn1	UniProtKB/Swiss-Prot
	MMR_HSR1	UniProtKB/Swiss-Prot
PhenoGen	Gnl3	PhenoGen
PROSITE	G_CP	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000028461	RatGTEx
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot
UniProt	A6KG10	ENTREZGENE, UniProtKB/TrEMBL
	A6KG11	ENTREZGENE, UniProtKB/TrEMBL
	A6KG12_RAT	UniProtKB/TrEMBL
	GNL3_RAT	UniProtKB/Swiss-Prot
	Q566E0	ENTREZGENE
	Q811S9	ENTREZGENE
UniProt Secondary	Q566E0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-15	Gnl3	G protein nucleolar 3	Gnl3	guanine nucleotide binding protein-like 3 (nucleolar)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-03-14	Gnl3	guanine nucleotide binding protein-like 3 (nucleolar)	Ns	nucleostemin	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2004-02-11	Ns	nucleostemin			Symbol and Name status set to approved	625702	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the nucleoli of CNS stem cells, embryonic stem cells, and several cancer cell lines	633365

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Annotations - KEGG (archival)