Advanced Search (OLGA)

Gene: Scarb2 (scavenger receptor class B, member 2) Rattus norvegicus

Analyze

Symbol:

Scarb2

Name:

scavenger receptor class B, member 2

RGD ID:

621882

Description:

Predicted to enable several functions, including cholesterol binding activity; phospholipid binding activity; and protein homodimerization activity. Involved in positive regulation of neuron projection development. Predicted to be located in endocytic vesicle membrane and lysosomal lumen. Predicted to be active in lysosomal membrane and plasma membrane. Human ortholog(s) of this gene implicated in progressive myoclonus epilepsy 4. Orthologous to human SCARB2 (scavenger receptor class B member 2); INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

85 kDa lysosomal membrane sialoglycoprotein; CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2; CD36 antigen-like 2; Cd36l2; LGP85; LIMP II; LimpII; lysosome membrane protein 2; lysosome membrane protein II; scavenger receptor class B member 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SCARB2 (scavenger receptor class B member 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Scarb2 (scavenger receptor class B, member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Scarb2 (scavenger receptor class B member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SCARB2 (scavenger receptor class B member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SCARB2 (scavenger receptor class B member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Scarb2 (scavenger receptor class B member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SCARB2 (scavenger receptor class B member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SCARB2 (scavenger receptor class B member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Scarb2 (scavenger receptor class B member 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	TMCC2 (transmembrane and coiled-coil domain family 2)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SCARB2 (scavenger receptor class B member 2)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Scarb2 (scavenger receptor class B, member 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	scarb2c (scavenger receptor class B, member 2c)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	scav-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	scav-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG10345	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG3829	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	scarb2a	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	scarb2b	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG40006	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	dsb	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	emp	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	scav-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	scav-5	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Caenorhabditis elegans (roundworm):	scav-6	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	CG2736	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	scarb2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	15,842,583 - 15,894,123 (+)	NCBI		GRCr8
mRatBN7.2	14	15,558,271 - 15,609,813 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	15,558,236 - 15,609,813 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	15,566,223 - 15,618,045 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	16,885,066 - 16,936,897 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	15,580,484 - 15,632,314 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	17,064,173 - 17,115,620 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	17,064,353 - 17,115,963 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	16,980,270 - 17,031,712 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	17,119,366 - 17,170,850 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	17,119,365 - 17,170,850 (+)	NCBI
Celera	14	14,952,893 - 15,004,293 (+)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

benign epilepsy with centrotemporal spikes (ISO)

COVID-19 (ISO)

epilepsy (ISO)

focal segmental glomerulosclerosis (ISO)

focal segmental glomerulosclerosis 1 (ISO)

genetic disease (ISO)

Myoclonic Epilepsies (ISO)

progressive myoclonus epilepsy (ISO,ISS)

progressive myoclonus epilepsy 4 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-acetamidofluorene (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrolein (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amitrole (EXP)

ammonium chloride (EXP)

ampicillin (EXP)

aristolochic acid A (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chlordecone (ISO)

choline (ISO)

cisplatin (ISO)

clofibrate (ISO)

copper atom (ISO)

copper(0) (ISO)

corosolic acid (ISO)

coumestrol (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

decabromodiphenyl ether (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dichlorvos (EXP)

diethylstilbestrol (ISO)

Enterolactone (ISO)

ethanol (ISO)

fenthion (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

genistein (EXP,ISO)

gentamycin (EXP)

isoprenaline (ISO)

ivermectin (ISO)

ketoconazole (ISO)

L-methionine (ISO)

leflunomide (EXP,ISO)

lipopolysaccharide (ISO)

LY294002 (ISO)

methimazole (EXP)

methoxychlor (EXP)

metronidazole (EXP)

N,N-diethyl-m-toluamide (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-methyl-N-nitrosourea (EXP)

nefazodone (EXP)

neomycin (EXP)

nimesulide (EXP)

Nutlin-3 (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

permethrin (EXP)

pirinixic acid (EXP,ISO)

resveratrol (ISO)

rotenone (ISO)

sarin (ISO)

SB 431542 (ISO)

sirolimus (ISO)

sodium dichromate (EXP)

sunitinib (ISO)

tauroursodeoxycholic acid (EXP)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

tetrachloroethene (ISO)

thioacetamide (EXP)

topotecan (EXP)

urethane (ISO)

valdecoxib (EXP)

valproic acid (ISO)

vancomycin (EXP)

Yessotoxin (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aminophospholipid transport (IEA,ISO)

endosome to plasma membrane protein transport (IEA,ISO)

positive regulation of neuron projection development (IDA)

protein targeting to lysosome (IBA,IEA,ISO)

receptor-mediated endocytosis (IBA,IEA,ISO)

regulation of carbohydrate catabolic process (IEA,ISO)

regulation of glucosylceramidase activity (ISO)

sensory perception of sound (IEA,ISO)

vesicle-mediated transport (IEA)

Cellular Component

endocytic vesicle membrane (IEA,ISO)

lysosomal lumen (IEA,ISO)

lysosomal membrane (IBA,IEA,ISO,ISS,TAS)

lysosome (IEA)

membrane (IEA)

plasma membrane (IBA,IEA,ISO)

Molecular Function

cargo receptor activity (ISO)

cholesterol binding (IEA,ISO)

enzyme binding (IEA,ISO)

phosphatidylcholine binding (IEA,ISO)

phosphatidylserine binding (IEA,ISO)

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

protein-folding chaperone binding (IEA,ISO)

scavenger receptor activity (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	A multilevel screening strategy defines a molecular fingerprint of proregenerative olfactory ensheathing cells and identifies SCARB2, a protein that improves regenerative sprouting of injured sensory spinal axons.	Roet KC, etal., J Neurosci. 2013 Jul 3;33(27):11116-35. doi: 10.1523/JNEUROSCI.1002-13.2013.
10.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
11.	Cloning, sequencing, and expression of a cDNA encoding rat LIMP II, a novel 74-kDa lysosomal membrane protein related to the surface adhesion protein CD36.	Vega MA, etal., J Biol Chem 1991 Sep 5;266(25):16818-24.

Additional References at PubMed

PMID:1859403	PMID:15489334	PMID:16138903	PMID:17897319	PMID:18022370	PMID:19056867	PMID:19946888	PMID:21423176	PMID:23376485	PMID:23533145	PMID:25202012	PMID:25316793
PMID:27789271	PMID:29199275	PMID:32007273	PMID:33010890	PMID:35352799

Genomics

Comparative Map Data

Scarb2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	14	15,842,583 - 15,894,123 (+)	NCBI		GRCr8
mRatBN7.2	14	15,558,271 - 15,609,813 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	14	15,558,236 - 15,609,813 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	14	15,566,223 - 15,618,045 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	14	16,885,066 - 16,936,897 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	14	15,580,484 - 15,632,314 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	14	17,064,173 - 17,115,620 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	14	17,064,353 - 17,115,963 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	16,980,270 - 17,031,712 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	17,119,366 - 17,170,850 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	14	17,119,365 - 17,170,850 (+)	NCBI
Celera	14	14,952,893 - 15,004,293 (+)	NCBI		Celera
Cytogenetic Map	14	p22	NCBI

SCARB2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	4	76,158,737 - 76,234,532 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	4	76,158,737 - 76,234,536 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	4	77,079,890 - 77,134,977 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	4	77,298,918 - 77,354,059 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	4	77,437,072 - 77,492,214	NCBI
Celera	4	74,380,030 - 74,435,161 (-)	NCBI		Celera
Cytogenetic Map	4	q21.1	NCBI
HuRef	4	72,831,916 - 72,887,070 (-)	NCBI		HuRef
CHM1_1	4	77,056,276 - 77,111,407 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	4	79,499,409 - 79,554,492 (-)	NCBI		T2T-CHM13v2.0

Scarb2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	5	92,589,170 - 92,653,516 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	5	92,589,173 - 92,654,692 (-)	Ensembl		GRCm39 Ensembl
GRCm38	5	92,441,311 - 92,505,657 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	5	92,441,314 - 92,506,833 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	5	92,872,899 - 92,934,634 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	5	93,519,073 - 93,580,808 (-)	NCBI		MGSCv36	mm8
Celera	5	90,592,338 - 90,656,687 (-)	NCBI		Celera
Cytogenetic Map	5	E2	NCBI
cM Map	5	46.82	NCBI

Scarb2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955433	884,740 - 962,932 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955433	884,740 - 962,932 (-)	NCBI	ChiLan1.0	ChiLan1.0

SCARB2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	3	53,859,642 - 53,914,850 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	4	54,049,355 - 54,104,570 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	4	47,992,589 - 48,047,528 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	4	53,830,488 - 53,886,065 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	4	53,830,488 - 53,886,059 (+)	Ensembl	panpan1.1		panPan2

SCARB2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	32	788,117 - 865,496 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	32	790,379 - 865,502 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	32	41,016,853 - 41,094,397 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	32	814,945 - 891,722 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	32	814,948 - 891,728 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	32	812,765 - 889,655 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	32	767,039 - 843,700 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	32	39,325,616 - 39,402,476 (+)	NCBI		UU_Cfam_GSD_1.0

Scarb2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405285	11,281,403 - 11,339,761 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936676	170,010 - 225,457 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936676	167,482 - 225,827 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SCARB2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	8	71,838,397 - 71,940,607 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	8	71,838,395 - 71,910,461 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	8	76,034,114 - 76,105,880 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SCARB2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	7	24,658,734 - 24,714,631 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	7	24,658,211 - 24,714,597 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666037	3,007,021 - 3,062,819 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Scarb2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624757	14,709,120 - 14,795,243 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624757	14,709,120 - 14,795,039 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Scarb2
421 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	40
Count of miRNA genes:	32
Interacting mature miRNAs:	36
Transcripts:	ENSRNOT00000003052
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3813074	21217635	Rat
2293089	Iddm31	Insulin dependent diabetes mellitus QTL 31	4.7		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	14	3813074	18274691	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11030812	30320092	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	28035204	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3813074	30767156	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3813074	24531477	Rat
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
70204	Niddm20	Non-insulin dependent diabetes mellitus QTL 20	5.1	0.000008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	14	1217606	16960180	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	14875168	30883947	Rat

Markers in Region

D14Got18

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	15,559,987 - 15,560,158 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	17,065,890 - 17,066,060	NCBI	Rnor6.0
Rnor_5.0	14	16,981,987 - 16,982,157	UniSTS	Rnor5.0
RGSC_v3.4	14	17,121,082 - 17,121,253	RGD	RGSC3.4
RGSC_v3.4	14	17,121,083 - 17,121,253	UniSTS	RGSC3.4
RGSC_v3.1	14	17,121,083 - 17,121,253	RGD
Celera	14	14,954,610 - 14,954,780	UniSTS
RH 3.4 Map	14	190.0	UniSTS
RH 3.4 Map	14	190.0	RGD
RH 2.0 Map	14	203.0	RGD
Cytogenetic Map	14	p22	UniSTS

D14Got20

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	15,589,153 - 15,589,333 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	17,094,964 - 17,095,141	NCBI	Rnor6.0
Rnor_5.0	14	17,011,056 - 17,011,233	UniSTS	Rnor5.0
RGSC_v3.4	14	17,150,193 - 17,150,371	RGD	RGSC3.4
RGSC_v3.4	14	17,150,194 - 17,150,371	UniSTS	RGSC3.4
RGSC_v3.1	14	17,150,193 - 17,150,371	RGD
Celera	14	14,983,663 - 14,983,840	UniSTS
RH 2.0 Map	14	206.9	RGD
Cytogenetic Map	14	p22	UniSTS

BM390590

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	15,597,845 - 15,598,059 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	17,103,653 - 17,103,866	NCBI	Rnor6.0
Rnor_5.0	14	17,019,745 - 17,019,958	UniSTS	Rnor5.0
RGSC_v3.4	14	17,158,883 - 17,159,096	UniSTS	RGSC3.4
Celera	14	14,992,326 - 14,992,539	UniSTS
RH 3.4 Map	14	213.1	UniSTS
Cytogenetic Map	14	p22	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_054001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC103535	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061853	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474060	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D10587	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000014	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M68965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000003052 ⟹ ENSRNOP00000003052

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	15,558,236 - 15,608,502 (+)	Ensembl
Rnor_6.0 Ensembl	14	17,064,353 - 17,115,963 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000102726 ⟹ ENSRNOP00000078097

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	15,576,813 - 15,609,813 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103647 ⟹ ENSRNOP00000097524

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	15,558,236 - 15,609,809 (+)	Ensembl

RefSeq Acc Id:

NM_054001 ⟹ NP_446453

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	14	15,842,583 - 15,894,123 (+)	NCBI
mRatBN7.2	14	15,558,271 - 15,609,813 (+)	NCBI
Rnor_6.0	14	17,064,173 - 17,115,620 (+)	NCBI
Rnor_5.0	14	16,980,270 - 17,031,712 (+)	NCBI
RGSC_v3.4	14	17,119,366 - 17,170,850 (+)	RGD
Celera	14	14,952,893 - 15,004,293 (+)	RGD

Sequence:

show sequence

CTCTGCGCGCTCCCTGCACCTCCCGGGCTGCAGCAGCCCGAGAAAACGAAAGCCAGGCGATCCC
AGCACCCGCGATCGCGCGGGCTCTGTGCTCCGAGGGCCGTGCTCGCCTGGTGCCTACTCCAGGG
CTGTGTACACCGCGCGGGCGGCGGCTGAGCCCGCACCAGGAGGGCGCGGGAGCCGCAGGGCCCT
GGAGCTTTGGGCGACTGCTACGCGGCCTTGGCCGAGGCTCTTCCTTGCTCGCCGTTCTGTCGCG
GGCCTGGCCCGTGAACCGCTCACAGTATGGCCCGATGCTGCTTCTACACGGCGGGGACACTGTC
TCTGCTGCTGCTGGTGACCAGTGTCACGCTGCTAGTGGCTCGAGTCTTTCAGAAGGCAGTGGAC
CAGACGATCGAGAAGAATATGGTATTACAAAATGGTACCAAGGTCTTTGATTCCTGGGAGAAGC
CCCCTCTACCTGTGTACATCCAGTTTTATTTCTTCAATGTCACCAATCCAGAGGAGATCCTCCA
AGGAGAAATCCCCCTGCTAGAAGAAGTGGGGCCGTACACCTACAGGGAGCTCAGGAACAAGGCA
AACGTTCAGTTTGGAGAAAATGGAACAACCATATCTGCCGTCACCAATAAGGCATATATTTTTG
AACGAAACCAGTCTGTTGGAGACCCTACCGTTGACTTGATTAGAACAATAAATATTCCTCTGTT
GACTGTTGTGGAAATGGCCCAGCAGCCCTTCCTCAGGGAGATCATCGAGGCCATGCTGAAAGCT
TATCAGCAGACGCTGTTTGTCACTCACACTGTACATGAACTGCTCTGGGGCTACAAAGATGAGG
TCTTGTCGCTCGTCCATATTTTCAGACCTGACGTCTCCCCTAACTTTGGCCTGTTCTATGAGAG
AAATGGAACTAATGATGGGGAGTATGTTTTTCTGACTGGAGAGGACAATTACCTGAACTTTACA
AAAATTGTGGAGTGGAATGGAAAAACGTCGCTGGACTGGTGGACGACGGACACGTGCAATATGA
TCAACGGGACAGACGGAGATTCTTTTCACCCATTAATAAGCAAGGATGAGACCCTGTACATCTT
CCCATCTGACTTCTGCAGGTCCGTCTATATAACTTTCAGTAGCTTTGAGAACGTAGAAGGACTG
CCTGCTTTTCGGTATAAGGTGCCTGCAGAAATACTAGCCAATTCCTCCGAAAACGCTGGCTTCT
GTATACCCGAGGGAAACTGCATGGACGCGGGAGTGCTGAACGTCAGCATTTGCAAGAATGGTGC
GCCCATTATCATGTCTTTCCCACACTTTTACCAAGCCGACGAGAAGTTCGTTTCGGCCATAAAA
GGCATGCGTCCAAACAAGGAAGAACATGAGTCATTTGTGGACATTAATCCTTTGACAGGAATTA
TTTTAAGAGGGGCCAAGAGATTCCAAATCAACACGTACGTTAAGAAGCTGGATGACTTTGTGGA
AACGGGAAACATTAGGACTATGGTTTTCCCAGTGATGTATCTCAATGAGAGTGTTCTCATTGAC
AAAGAGACTGCAAGTCAACTGAAGTCTGTGATTAACACAACTTTGATTGTCACCAACATACCCT
ACATCATCATGGCACTGGGCGTGTTCTTTGGCTTGATTTTCACGTGGCTGGCGTGTCGAGGACA
GGGGTCTACGGATGAGGGAACTGCAGATGAAAGGGCACCCCTCATACGGACCTAATGGGACTTA
CCTGTTGCCTGAGCTTGGTGAGAGAATGTGAGAACTGACCTGACCTGGACCAGGACAGGGAAAA
GCCTGCATCCTCACGGGCTCCTGGCCTGTCAAGAAGGGAGTGAAGCCGCAGCACTGGCACGCGA
GAAGACCCTCCTGGACAGAGGGGACCGAGCAGGTGACATGGCTGGCAATTACGCTTTATAAAAT
CATGTCTCTGAAACTGTGTCAATGTGTCTTAGGGAGTATTTAATAAATTGTGTAGAAACCTTTA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446453	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41531	(Get FASTA)	NCBI Sequence Viewer
	AAH61853	(Get FASTA)	NCBI Sequence Viewer
	BAA01444	(Get FASTA)	NCBI Sequence Viewer
	EDL88640	(Get FASTA)	NCBI Sequence Viewer
	EDL88641	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000003052.5
	ENSRNOP00000078097.1
	ENSRNOP00000097524.1
	ENSRNOP00055008208
	ENSRNOP00060026114
	ENSRNOP00065023873
GenBank Protein	P27615	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_446453 ⟸ NM_054001

- UniProtKB:

P27615 (UniProtKB/Swiss-Prot), A6KK69 (UniProtKB/TrEMBL), A0A8L2Q0Y1 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MARCCFYTAGTLSLLLLVTSVTLLVARVFQKAVDQTIEKNMVLQNGTKVFDSWEKPPLPVYIQF
YFFNVTNPEEILQGEIPLLEEVGPYTYRELRNKANVQFGENGTTISAVTNKAYIFERNQSVGDP
TVDLIRTINIPLLTVVEMAQQPFLREIIEAMLKAYQQTLFVTHTVHELLWGYKDEVLSLVHIFR
PDVSPNFGLFYERNGTNDGEYVFLTGEDNYLNFTKIVEWNGKTSLDWWTTDTCNMINGTDGDSF
HPLISKDETLYIFPSDFCRSVYITFSSFENVEGLPAFRYKVPAEILANSSENAGFCIPEGNCMD
AGVLNVSICKNGAPIIMSFPHFYQADEKFVSAIKGMRPNKEEHESFVDINPLTGIILRGAKRFQ
INTYVKKLDDFVETGNIRTMVFPVMYLNESVLIDKETASQLKSVINTTLIVTNIPYIIMALGVF
FGLIFTWLACRGQGSTDEGTADERAPLIRT

hide sequence

Ensembl Acc Id:

ENSRNOP00000003052 ⟸ ENSRNOT00000003052

Ensembl Acc Id:

ENSRNOP00000078097 ⟸ ENSRNOT00000102726

Ensembl Acc Id:

ENSRNOP00000097524 ⟸ ENSRNOT00000103647

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P27615-F1-model_v2	AlphaFold	P27615	1-478	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:621882	AgrOrtholog
BioCyc Gene	G2FUF-16267	BioCyc
Ensembl Genes	ENSRNOG00000002225	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00055006490	UniProtKB/Swiss-Prot
	ENSRNOG00060018619	UniProtKB/Swiss-Prot
	ENSRNOG00065017922	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000003052.7	UniProtKB/TrEMBL
	ENSRNOT00000102726.1	UniProtKB/TrEMBL
	ENSRNOT00000103647.1	UniProtKB/Swiss-Prot
	ENSRNOT00055010565	UniProtKB/Swiss-Prot
	ENSRNOT00060032097	UniProtKB/Swiss-Prot
	ENSRNOT00065030030	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5621697	IMAGE-MGC_LOAD
InterPro	CD36_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LimpII	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:117106	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72341	IMAGE-MGC_LOAD
NCBI Gene	117106	ENTREZGENE
PANTHER	LYSOSOME MEMBRANE PROTEIN 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11923	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CD36	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Scarb2	PhenoGen
PRINTS	CD36FAMILY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	LIMPII	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000002225	RatGTEx
	ENSRNOG00055006490	RatGTEx
	ENSRNOG00060018619	RatGTEx
	ENSRNOG00065017922	RatGTEx
UniProt	A0A8I5YC62_RAT	UniProtKB/TrEMBL
	A0A8L2Q0Y1	ENTREZGENE, UniProtKB/TrEMBL
	A6KK69	ENTREZGENE, UniProtKB/TrEMBL
	A6KK70_RAT	UniProtKB/TrEMBL
	P27615	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Scarb2	scavenger receptor class B, member 2		CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2	Name updated	1299863	APPROVED
2004-09-10	Scarb2	CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2	Cd36l2		Symbol and Name updated	1299863	APPROVED
2002-08-07	Cd36l2	CD36 antigen (collagen type I receptor, thrombospondin receptor)-like 2			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_homology	has a high degree of homology to cell adhesion protein CD36	632394
gene_protein	consists of 478 amino acid residues and has 11 potential N-glycosylation sites and 5 cysteine residues	632394

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM