Symbol:
Dkc1
Name:
dyskerin pseudouridine synthase 1
RGD ID:
621780
Description:
Predicted to enable box H/ACA snoRNA binding activity; pseudouridine synthase activity; and telomerase RNA binding activity. Predicted to contribute to telomerase activity. Involved in positive regulation of cell population proliferation and snoRNA guided rRNA pseudouridine synthesis. Located in Cajal body. Part of box H/ACA snoRNP complex. Human ortholog(s) of this gene implicated in X-linked dyskeratosis congenita; aplastic anemia; and dyskeratosis congenita. Orthologous to human DKC1 (dyskerin pseudouridine synthase 1); PARTICIPATES IN ribosome biogenesis pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran.
Type:
protein-coding
RefSeq Status:
PROVISIONAL
Previously known as:
dyskeratosis congenita 1, dyskerin; dyskerin; h/ACA ribonucleoprotein complex subunit 4; H/ACA ribonucleoprotein complex subunit DKC1; Nap57; nopp140-associated protein of 57 kDa; nucleolar protein family A member 4; nucleolar protein NAP57; snoRNP protein DKC1
RGD Orthologs
Alliance Orthologs
More Info
more info ...
More Info
Latest Assembly:
GRCr8 - GRCr8 Assembly
NCBI Annotation Information:
Annotation category: suggests misassembly; Annotation category: partial on reference assembly
Position:
Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 157,751,651 - 157,757,796 (+) NCBI GRCr8 UTH_Rnor_SHR_Utx Y 2,037,843 - 2,053,706 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 158,304,360 - 158,320,224 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 155,976,554 - 155,992,422 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 155,844,914 - 155,862,363 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 155,844,857 - 155,862,475 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 151,564,354 - 151,578,635 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 1 135,295,501 - 135,310,658 (-) ENTREZGENE Celera Cytogenetic Map X ;Y NCBI
JBrowse:
View Region in Genome Browser (JBrowse)
Model
Only show annotations with direct experimental evidence (0 objects hidden)
Dkc1 Rat (+)-schisandrin B multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DKC1 mRNA] CTD PMID:31150632 Dkc1 Rat (-)-alpha-phellandrene decreases expression ISO DKC1 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of DKC1 mRNA CTD PMID:25075043 Dkc1 Rat 1-chloro-2,4-dinitrobenzene decreases expression ISO DKC1 (Homo sapiens) 6480464 Dinitrochlorobenzene results in decreased expression of DKC1 mRNA CTD PMID:17374397 Dkc1 Rat 17beta-estradiol increases expression ISO DKC1 (Homo sapiens) 6480464 Estradiol results in increased expression of DKC1 mRNA CTD PMID:23019147 and PMID:31614463 Dkc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO DKC1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DKC1 mRNA CTD PMID:20106945 and PMID:21632981 Dkc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression EXP 6480464 Tetrachlorodibenzodioxin results in decreased expression of DKC1 mRNA CTD PMID:20959002 and PMID:32109520 Dkc1 Rat 2,3,7,8-tetrachlorodibenzodioxine increases expression ISO DKC1 (Homo sapiens) 6480464 Tetrachlorodibenzodioxin results in increased expression of DKC1 mRNA CTD PMID:22903824 Dkc1 Rat 2,3,7,8-tetrachlorodibenzodioxine decreases expression ISO Dkc1 (Mus musculus) 6480464 Tetrachlorodibenzodioxin results in decreased expression of DKC1 mRNA CTD PMID:19770486 Dkc1 Rat 2,3,7,8-Tetrachlorodibenzofuran decreases expression EXP 6480464 2 more ... CTD PMID:32109520 Dkc1 Rat 2,4,6-tribromophenol decreases expression ISO DKC1 (Homo sapiens) 6480464 2 more ... CTD PMID:31675489 Dkc1 Rat 2,4-dinitrotoluene affects expression EXP 6480464 2 and 4-dinitrotoluene affects the expression of DKC1 mRNA CTD PMID:21346803 Dkc1 Rat 2-bromohexadecanoic acid multiple interactions ISO DKC1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DKC1 protein] CTD PMID:38195004 Dkc1 Rat 2-butoxyethanol increases expression ISO Dkc1 (Mus musculus) 6480464 n-butoxyethanol results in increased expression of DKC1 mRNA CTD PMID:19812364 Dkc1 Rat 2-nitrofluorene decreases expression EXP 6480464 2-nitrofluorene results in decreased expression of DKC1 mRNA CTD PMID:15890375 Dkc1 Rat 3,3',5,5'-tetrabromobisphenol A increases expression ISO DKC1 (Homo sapiens) 6480464 tetrabromobisphenol A results in increased expression of DKC1 protein CTD PMID:31675489 Dkc1 Rat 3-chloropropane-1,2-diol increases expression EXP 6480464 alpha-Chlorohydrin results in increased expression of DKC1 protein CTD PMID:34915118 Dkc1 Rat 4,4'-sulfonyldiphenol increases expression ISO Dkc1 (Mus musculus) 6480464 bisphenol S results in increased expression of DKC1 mRNA CTD PMID:39298647 Dkc1 Rat 4,4'-sulfonyldiphenol multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DKC1 mRNA CTD PMID:36041667 Dkc1 Rat 4-(ethoxymethylene)-2-phenyloxazol-5-one decreases expression ISO DKC1 (Homo sapiens) 6480464 Oxazolone results in decreased expression of DKC1 mRNA CTD PMID:17374397 Dkc1 Rat 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one increases expression EXP 6480464 4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of DKC1 mRNA CTD PMID:15890375 Dkc1 Rat 4-amino-2,6-dinitrotoluene affects expression EXP 6480464 4-amino-2 and 6-dinitrotoluene affects the expression of DKC1 mRNA CTD PMID:21346803 Dkc1 Rat afimoxifene multiple interactions ISO DKC1 (Homo sapiens) 6480464 afimoxifene inhibits the reaction [Estrogens results in increased expression of DKC1 mRNA] CTD PMID:21233418 Dkc1 Rat aflatoxin B1 increases expression EXP 6480464 Aflatoxin B1 results in increased expression of DKC1 mRNA CTD PMID:15890375 Dkc1 Rat aflatoxin B1 increases expression ISO DKC1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased expression of DKC1 mRNA CTD PMID:22100608 and PMID:27153756 Dkc1 Rat aflatoxin B1 increases methylation ISO DKC1 (Homo sapiens) 6480464 Aflatoxin B1 results in increased methylation of DKC1 gene CTD PMID:27153756 Dkc1 Rat aflatoxin B1 decreases expression ISO Dkc1 (Mus musculus) 6480464 Aflatoxin B1 results in decreased expression of DKC1 mRNA CTD PMID:19770486 Dkc1 Rat alpha-phellandrene decreases expression ISO DKC1 (Homo sapiens) 6480464 alpha phellandrene results in decreased expression of DKC1 mRNA CTD PMID:25075043 Dkc1 Rat arsane decreases expression ISO DKC1 (Homo sapiens) 6480464 Arsenic results in decreased expression of DKC1 mRNA CTD PMID:25460668 Dkc1 Rat arsenic atom decreases expression ISO DKC1 (Homo sapiens) 6480464 Arsenic results in decreased expression of DKC1 mRNA CTD PMID:25460668 Dkc1 Rat benzo[a]pyrene increases expression ISO DKC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased expression of DKC1 mRNA CTD PMID:20498004 Dkc1 Rat benzo[a]pyrene increases methylation ISO DKC1 (Homo sapiens) 6480464 Benzo(a)pyrene results in increased methylation of DKC1 exon and Benzo(a)pyrene results in increased methylation of DKC1 promoter CTD PMID:27901495 Dkc1 Rat benzo[a]pyrene decreases expression ISO Dkc1 (Mus musculus) 6480464 Benzo(a)pyrene results in decreased expression of DKC1 mRNA CTD PMID:19770486 Dkc1 Rat benzo[a]pyrene diol epoxide I decreases expression ISO DKC1 (Homo sapiens) 6480464 7 more ... CTD PMID:20382639 Dkc1 Rat bicalutamide decreases expression ISO DKC1 (Homo sapiens) 6480464 bicalutamide results in decreased expression of DKC1 mRNA CTD PMID:15638997 Dkc1 Rat bis(2-chloroethyl) sulfide increases phosphorylation ISO DKC1 (Homo sapiens) 6480464 Mustard Gas results in increased phosphorylation of DKC1 protein CTD PMID:19845377 Dkc1 Rat bis(2-chloroethyl) sulfide decreases expression ISO DKC1 (Homo sapiens) 6480464 Mustard Gas results in decreased expression of DKC1 mRNA CTD PMID:25102026 Dkc1 Rat bisphenol A affects expression EXP 6480464 bisphenol A affects the expression of DKC1 mRNA CTD PMID:25181051 Dkc1 Rat bisphenol A multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DKC1 mRNA CTD PMID:36041667 Dkc1 Rat bisphenol A decreases expression ISO DKC1 (Homo sapiens) 6480464 bisphenol A results in decreased expression of DKC1 protein CTD PMID:31675489 Dkc1 Rat bisphenol A decreases expression ISO Dkc1 (Mus musculus) 6480464 bisphenol A results in decreased expression of DKC1 mRNA CTD PMID:33221593 Dkc1 Rat bisphenol A increases expression EXP 6480464 bisphenol A results in increased expression of DKC1 protein CTD PMID:32145629 Dkc1 Rat bisphenol A decreases expression EXP 6480464 bisphenol A results in decreased expression of DKC1 mRNA CTD PMID:33296240 Dkc1 Rat bisphenol A affects expression ISO DKC1 (Homo sapiens) 6480464 bisphenol A affects the expression of DKC1 mRNA CTD PMID:30903817 Dkc1 Rat bisphenol AF increases expression ISO DKC1 (Homo sapiens) 6480464 bisphenol AF results in increased expression of DKC1 protein CTD PMID:34186270 Dkc1 Rat Bisphenol B increases expression ISO DKC1 (Homo sapiens) 6480464 bisphenol B results in increased expression of DKC1 protein CTD PMID:34186270 Dkc1 Rat bisphenol F multiple interactions EXP 6480464 [bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in decreased expression of DKC1 mRNA CTD PMID:36041667 Dkc1 Rat C60 fullerene decreases expression EXP 6480464 fullerene C60 results in decreased expression of DKC1 mRNA CTD PMID:19167457 Dkc1 Rat cadmium atom multiple interactions ISO DKC1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DKC1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DKC1 protein CTD PMID:38195004 Dkc1 Rat cadmium dichloride multiple interactions ISO DKC1 (Homo sapiens) 6480464 2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DKC1 protein] and [Cadmium Chloride results in increased abundance of Cadmium] which results in increased palmitoylation of DKC1 protein CTD PMID:38195004 Dkc1 Rat cadmium dichloride decreases expression ISO DKC1 (Homo sapiens) 6480464 Cadmium Chloride results in decreased expression of DKC1 mRNA CTD PMID:38568856 Dkc1 Rat caffeine decreases phosphorylation ISO DKC1 (Homo sapiens) 6480464 Caffeine results in decreased phosphorylation of DKC1 protein CTD PMID:35688186 Dkc1 Rat carbon nanotube increases expression ISO Dkc1 (Mus musculus) 6480464 Nanotubes and Carbon results in increased expression of DKC1 mRNA CTD PMID:25554681 Dkc1 Rat CGP 52608 multiple interactions ISO DKC1 (Homo sapiens) 6480464 CGP 52608 promotes the reaction [RORA protein binds to DKC1 gene] CTD PMID:28238834 Dkc1 Rat chloropicrin affects expression ISO DKC1 (Homo sapiens) 6480464 chloropicrin affects the expression of DKC1 mRNA CTD PMID:26352163 Dkc1 Rat choline multiple interactions ISO Dkc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DKC1 gene CTD PMID:20938992 Dkc1 Rat cisplatin increases phosphorylation ISO Dkc1 (Mus musculus) 6480464 Cisplatin results in increased phosphorylation of DKC1 protein CTD PMID:22006019 Dkc1 Rat cobalt dichloride decreases expression ISO DKC1 (Homo sapiens) 6480464 cobaltous chloride results in decreased expression of DKC1 mRNA CTD PMID:19320972 and PMID:19376846 Dkc1 Rat coumestrol multiple interactions ISO DKC1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 more ... CTD PMID:19167446 Dkc1 Rat coumestrol increases expression ISO DKC1 (Homo sapiens) 6480464 Coumestrol results in increased expression of DKC1 mRNA CTD PMID:19167446 Dkc1 Rat cyclosporin A decreases expression ISO DKC1 (Homo sapiens) 6480464 Cyclosporine results in decreased expression of DKC1 mRNA CTD PMID:22147139 Dkc1 Rat cyclosporin A increases expression ISO DKC1 (Homo sapiens) 6480464 Cyclosporine results in increased expression of DKC1 mRNA CTD PMID:20106945 and PMID:25562108 Dkc1 Rat decabromodiphenyl ether increases expression ISO DKC1 (Homo sapiens) 6480464 decabromobiphenyl ether results in increased expression of DKC1 protein CTD PMID:31675489 Dkc1 Rat deoxynivalenol decreases phosphorylation ISO Dkc1 (Mus musculus) 6480464 deoxynivalenol results in decreased phosphorylation of DKC1 protein CTD PMID:23811945 Dkc1 Rat diethylstilbestrol increases expression EXP 6480464 Diethylstilbestrol results in increased expression of DKC1 mRNA CTD PMID:15890375 Dkc1 Rat disodium selenite increases expression ISO DKC1 (Homo sapiens) 6480464 Sodium Selenite results in increased expression of DKC1 mRNA CTD PMID:18175754 Dkc1 Rat Enterolactone multiple interactions ISO DKC1 (Homo sapiens) 6480464 [Coumestrol co-treated with 2 and 3-bis(3'-hydroxybenzyl)butyrolactone] results in increased expression of DKC1 mRNA CTD PMID:19167446 Dkc1 Rat epoxiconazole decreases expression ISO Dkc1 (Mus musculus) 6480464 epoxiconazole results in decreased expression of DKC1 mRNA CTD PMID:35436446 Dkc1 Rat ethanol affects expression ISO Dkc1 (Mus musculus) 6480464 Ethanol affects the expression of DKC1 mRNA CTD PMID:30319688 Dkc1 Rat ethyl methanesulfonate decreases expression ISO DKC1 (Homo sapiens) 6480464 Ethyl Methanesulfonate results in decreased expression of DKC1 mRNA CTD PMID:23649840 Dkc1 Rat eugenol decreases expression ISO DKC1 (Homo sapiens) 6480464 Eugenol results in decreased expression of DKC1 mRNA CTD PMID:17374397 Dkc1 Rat finasteride increases expression EXP 6480464 Finasteride results in increased expression of DKC1 mRNA CTD PMID:24136188 Dkc1 Rat flutamide increases expression EXP 6480464 Flutamide results in increased expression of DKC1 mRNA CTD PMID:24136188 Dkc1 Rat folic acid multiple interactions ISO Dkc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DKC1 gene CTD PMID:20938992 Dkc1 Rat folic acid decreases expression ISO Dkc1 (Mus musculus) 6480464 Folic Acid results in decreased expression of DKC1 mRNA CTD PMID:25629700 Dkc1 Rat folpet decreases expression ISO Dkc1 (Mus musculus) 6480464 folpet results in decreased expression of DKC1 mRNA CTD PMID:31558096 Dkc1 Rat FR900359 affects phosphorylation ISO DKC1 (Homo sapiens) 6480464 FR900359 affects the phosphorylation of DKC1 protein CTD PMID:37730182 Dkc1 Rat glyphosate affects methylation EXP 6480464 Glyphosate affects the methylation of DKC1 gene CTD PMID:35440735 Dkc1 Rat glyphosate increases expression ISO Dkc1 (Mus musculus) 6480464 Glyphosate results in increased expression of DKC1 protein CTD PMID:37208198 Dkc1 Rat hexadecanoic acid decreases phosphorylation ISO DKC1 (Homo sapiens) 6480464 Palmitic Acid results in decreased phosphorylation of DKC1 protein CTD PMID:28073184 Dkc1 Rat hydrogen peroxide affects expression ISO DKC1 (Homo sapiens) 6480464 Hydrogen Peroxide affects the expression of DKC1 mRNA CTD PMID:20044591 Dkc1 Rat ivermectin decreases expression ISO DKC1 (Homo sapiens) 6480464 Ivermectin results in decreased expression of DKC1 protein CTD PMID:32959892 Dkc1 Rat L-methionine multiple interactions ISO Dkc1 (Mus musculus) 6480464 [Methionine deficiency co-treated with Choline deficiency co-treated with Folic Acid deficiency] results in increased methylation of DKC1 gene CTD PMID:20938992 Dkc1 Rat lead(0) affects expression ISO DKC1 (Homo sapiens) 6480464 Lead affects the expression of DKC1 mRNA CTD PMID:28903495 Dkc1 Rat menadione affects expression ISO DKC1 (Homo sapiens) 6480464 Vitamin K 3 affects the expression of DKC1 mRNA CTD PMID:20044591 Dkc1 Rat methapyrilene increases expression EXP 6480464 Methapyrilene results in increased expression of DKC1 mRNA CTD PMID:15890375 Dkc1 Rat methoxychlor affects methylation EXP 6480464 Methoxychlor affects the methylation of DKC1 gene CTD PMID:35440735 Dkc1 Rat methyl methanesulfonate decreases expression ISO DKC1 (Homo sapiens) 6480464 Methyl Methanesulfonate results in decreased expression of DKC1 mRNA CTD PMID:23649840 Dkc1 Rat methylmercury chloride increases expression ISO DKC1 (Homo sapiens) 6480464 methylmercuric chloride results in increased expression of DKC1 mRNA CTD PMID:28001369 Dkc1 Rat methylparaben increases expression ISO DKC1 (Homo sapiens) 6480464 methylparaben results in increased expression of DKC1 mRNA CTD PMID:31745603 Dkc1 Rat methylseleninic acid decreases expression ISO DKC1 (Homo sapiens) 6480464 methylselenic acid results in decreased expression of DKC1 mRNA CTD PMID:18548127 Dkc1 Rat N,N-diethyl-m-toluamide multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of DKC1 gene CTD PMID:33148267 Dkc1 Rat N-nitrosodimethylamine increases expression EXP 6480464 Dimethylnitrosamine results in increased expression of DKC1 mRNA CTD PMID:15890375 Dkc1 Rat nickel sulfate decreases expression ISO DKC1 (Homo sapiens) 6480464 nickel sulfate results in decreased expression of DKC1 mRNA CTD PMID:16780908 and PMID:17374397 Dkc1 Rat oxaliplatin multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DKC1 mRNA CTD PMID:25729387 Dkc1 Rat oxaliplatin decreases expression EXP 6480464 oxaliplatin results in decreased expression of DKC1 mRNA CTD PMID:25729387 Dkc1 Rat paraquat increases expression EXP 6480464 Paraquat results in increased expression of DKC1 mRNA CTD PMID:32680482 Dkc1 Rat pentachlorophenol increases expression ISO Dkc1 (Mus musculus) 6480464 Pentachlorophenol results in increased expression of DKC1 mRNA CTD PMID:23892564 Dkc1 Rat perfluorononanoic acid increases expression ISO DKC1 (Homo sapiens) 6480464 perfluoro-n-nonanoic acid results in increased expression of DKC1 mRNA CTD PMID:32588087 Dkc1 Rat perfluorooctanoic acid increases expression EXP 6480464 perfluorooctanoic acid results in increased expression of DKC1 mRNA CTD PMID:19162173 Dkc1 Rat permethrin multiple interactions EXP 6480464 [Permethrin co-treated with DEET] results in decreased methylation of DKC1 gene CTD PMID:33148267 Dkc1 Rat phenobarbital affects expression ISO Dkc1 (Mus musculus) 6480464 Phenobarbital affects the expression of DKC1 mRNA CTD PMID:23091169 Dkc1 Rat piperonyl butoxide increases expression EXP 6480464 Piperonyl Butoxide results in increased expression of DKC1 mRNA CTD PMID:15890375 Dkc1 Rat pirinixic acid increases expression EXP 6480464 pirinixic acid results in increased expression of DKC1 mRNA CTD PMID:15890375 Dkc1 Rat resveratrol multiple interactions ISO DKC1 (Homo sapiens) 6480464 [Coumestrol co-treated with Resveratrol] results in increased expression of DKC1 mRNA and [Plant Extracts co-treated with Resveratrol] results in increased expression of DKC1 mRNA CTD PMID:19167446 and PMID:23557933 Dkc1 Rat rotenone increases expression EXP 6480464 Rotenone results in increased expression of DKC1 protein CTD PMID:35544339 Dkc1 Rat SB 431542 multiple interactions ISO DKC1 (Homo sapiens) 6480464 [LDN 193189 co-treated with 4-(5-benzo(1 and 3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in decreased expression of DKC1 protein CTD PMID:37664457 Dkc1 Rat silicon dioxide increases expression ISO DKC1 (Homo sapiens) 6480464 Silicon Dioxide analog results in increased expression of DKC1 mRNA CTD PMID:25895662 Dkc1 Rat sodium arsenite decreases expression ISO DKC1 (Homo sapiens) 6480464 sodium arsenite results in decreased expression of DKC1 mRNA CTD PMID:38568856 Dkc1 Rat Soman increases expression EXP 6480464 Soman results in increased expression of DKC1 mRNA CTD PMID:19281266 Dkc1 Rat succimer multiple interactions ISO Dkc1 (Mus musculus) 6480464 [Succimer binds to Magnetite Nanoparticles] which results in decreased expression of DKC1 mRNA CTD PMID:21641980 Dkc1 Rat temozolomide increases expression ISO DKC1 (Homo sapiens) 6480464 Temozolomide results in increased expression of DKC1 mRNA CTD PMID:31758290 Dkc1 Rat tetrachloromethane increases expression ISO Dkc1 (Mus musculus) 6480464 Carbon Tetrachloride results in increased expression of DKC1 mRNA CTD PMID:27339419 and PMID:31919559 Dkc1 Rat tetrachloromethane multiple interactions EXP 6480464 schizandrin B inhibits the reaction [Carbon Tetrachloride results in increased expression of DKC1 mRNA] CTD PMID:31150632 Dkc1 Rat tetrachloromethane increases expression EXP 6480464 Carbon Tetrachloride results in increased expression of DKC1 mRNA CTD PMID:31150632 Dkc1 Rat thiram decreases expression ISO DKC1 (Homo sapiens) 6480464 Thiram results in decreased expression of DKC1 mRNA CTD PMID:38568856 Dkc1 Rat titanium dioxide decreases methylation ISO Dkc1 (Mus musculus) 6480464 titanium dioxide results in decreased methylation of DKC1 gene CTD PMID:35295148 Dkc1 Rat topotecan multiple interactions EXP 6480464 [oxaliplatin co-treated with Topotecan] results in decreased expression of DKC1 mRNA CTD PMID:25729387 Dkc1 Rat Tributyltin oxide increases phosphorylation ISO Dkc1 (Mus musculus) 6480464 bis(tri-n-butyltin)oxide results in increased phosphorylation of DKC1 protein CTD PMID:22174045 Dkc1 Rat triphenyl phosphate affects expression ISO DKC1 (Homo sapiens) 6480464 triphenyl phosphate affects the expression of DKC1 mRNA CTD PMID:37042841 Dkc1 Rat triptonide decreases expression ISO Dkc1 (Mus musculus) 6480464 triptonide results in decreased expression of DKC1 mRNA CTD PMID:33045310 Dkc1 Rat tungsten decreases expression ISO Dkc1 (Mus musculus) 6480464 Tungsten results in decreased expression of DKC1 mRNA CTD PMID:30912803 Dkc1 Rat urethane decreases expression ISO DKC1 (Homo sapiens) 6480464 Urethane results in decreased expression of DKC1 mRNA CTD PMID:28818685 Dkc1 Rat valproic acid decreases expression ISO DKC1 (Homo sapiens) 6480464 Valproic Acid results in decreased expression of DKC1 mRNA CTD PMID:19101580 Dkc1 Rat valproic acid decreases methylation ISO DKC1 (Homo sapiens) 6480464 Valproic Acid results in decreased methylation of DKC1 gene CTD PMID:29154799 Dkc1 Rat valproic acid affects expression ISO DKC1 (Homo sapiens) 6480464 Valproic Acid affects the expression of DKC1 mRNA CTD PMID:25979313
Imported Annotations - KEGG (archival)
(+)-schisandrin B (EXP) (-)-alpha-phellandrene (ISO) 1-chloro-2,4-dinitrobenzene (ISO) 17beta-estradiol (ISO) 2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO) 2,3,7,8-Tetrachlorodibenzofuran (EXP) 2,4,6-tribromophenol (ISO) 2,4-dinitrotoluene (EXP) 2-bromohexadecanoic acid (ISO) 2-butoxyethanol (ISO) 2-nitrofluorene (EXP) 3,3',5,5'-tetrabromobisphenol A (ISO) 3-chloropropane-1,2-diol (EXP) 4,4'-sulfonyldiphenol (EXP,ISO) 4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO) 4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP) 4-amino-2,6-dinitrotoluene (EXP) afimoxifene (ISO) aflatoxin B1 (EXP,ISO) alpha-phellandrene (ISO) arsane (ISO) arsenic atom (ISO) benzo[a]pyrene (ISO) benzo[a]pyrene diol epoxide I (ISO) bicalutamide (ISO) bis(2-chloroethyl) sulfide (ISO) bisphenol A (EXP,ISO) bisphenol AF (ISO) Bisphenol B (ISO) bisphenol F (EXP) C60 fullerene (EXP) cadmium atom (ISO) cadmium dichloride (ISO) caffeine (ISO) carbon nanotube (ISO) CGP 52608 (ISO) chloropicrin (ISO) choline (ISO) cisplatin (ISO) cobalt dichloride (ISO) coumestrol (ISO) cyclosporin A (ISO) decabromodiphenyl ether (ISO) deoxynivalenol (ISO) diethylstilbestrol (EXP) disodium selenite (ISO) Enterolactone (ISO) epoxiconazole (ISO) ethanol (ISO) ethyl methanesulfonate (ISO) eugenol (ISO) finasteride (EXP) flutamide (EXP) folic acid (ISO) folpet (ISO) FR900359 (ISO) glyphosate (EXP,ISO) hexadecanoic acid (ISO) hydrogen peroxide (ISO) ivermectin (ISO) L-methionine (ISO) lead(0) (ISO) menadione (ISO) methapyrilene (EXP) methoxychlor (EXP) methyl methanesulfonate (ISO) methylmercury chloride (ISO) methylparaben (ISO) methylseleninic acid (ISO) N,N-diethyl-m-toluamide (EXP) N-nitrosodimethylamine (EXP) nickel sulfate (ISO) oxaliplatin (EXP) paraquat (EXP) pentachlorophenol (ISO) perfluorononanoic acid (ISO) perfluorooctanoic acid (EXP) permethrin (EXP) phenobarbital (ISO) piperonyl butoxide (EXP) pirinixic acid (EXP) resveratrol (ISO) rotenone (EXP) SB 431542 (ISO) silicon dioxide (ISO) sodium arsenite (ISO) Soman (EXP) succimer (ISO) temozolomide (ISO) tetrachloromethane (EXP,ISO) thiram (ISO) titanium dioxide (ISO) topotecan (EXP) Tributyltin oxide (ISO) triphenyl phosphate (ISO) triptonide (ISO) tungsten (ISO) urethane (ISO) valproic acid (ISO)
1.
Telomere phenotypes in females with heterozygous mutations in the dyskeratosis congenita 1 (DKC1) gene.
Alder JK, etal., Hum Mutat. 2013 Nov;34(11):1481-5. doi: 10.1002/humu.22397. Epub 2013 Sep 11.
2.
Stepwise RNP assembly at the site of H/ACA RNA transcription in human cells.
Darzacq X, etal., J Cell Biol. 2006 Apr 24;173(2):207-18. Epub 2006 Apr 17.
3.
Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.
Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.
X-linked dyskeratosis congenita is caused by mutations in a highly conserved gene with putative nucleolar functions.
Heiss NS, etal., Nat Genet 1998 May;19(1):32-8.
5.
X-linked dyskeratosis congenita is predominantly caused by missense mutations in the DKC1 gene.
Knight SW, etal., Am J Hum Genet. 1999 Jul;65(1):50-8.
6.
Unexplained aplastic anaemia, immunodeficiency, and cerebellar hypoplasia (Hoyeraal-Hreidarsson syndrome) due to mutations in the dyskeratosis congenita gene, DKC1.
Knight SW, etal., Br J Haematol. 1999 Nov;107(2):335-9.
7.
NAP57, a mammalian nucleolar protein with a putative homolog in yeast and bacteria.
Meier UT and Blobel G, J Cell Biol 1994 Dec;127(6 Pt 1):1505-14.
8.
Electronic Transfer of LocusLink and RefSeq Data
NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.
OMIM Disease Annotation Pipeline
OMIM Disease Annotation Pipeline
10.
KEGG Annotation Import Pipeline
Pipeline to import KEGG annotations from KEGG into RGD
11.
Changes in the expression of telomere maintenance genes suggest global telomere dysfunction in B-chronic lymphocytic leukemia.
Poncet D, etal., Blood. 2008 Feb 15;111(4):2388-91. Epub 2007 Dec 12.
12.
GOA pipeline
RGD automated data pipeline
13.
ClinVar Automated Import and Annotation Pipeline
RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.
Data Import for Chemical-Gene Interactions
RGD automated import pipeline for gene-chemical interactions
15.
Dyskeratosis congenita and cancer in mice deficient in ribosomal RNA modification.
Ruggero D, etal., Science. 2003 Jan 10;299(5604):259-62.
16.
Mutational analysis of telomere complex genes in Indian population with acquired aplastic anemia.
Singh I, etal., Leuk Res. 2015 Sep 7. pii: S0145-2126(15)30370-2. doi: 10.1016/j.leukres.2015.08.018.
17.
Architecture and assembly of mammalian H/ACA small nucleolar and telomerase ribonucleoproteins.
Wang C and Meier UT, EMBO J. 2004 Apr 21;23(8):1857-67. Epub 2004 Mar 25.
18.
Immunopurified small nucleolar ribonucleoprotein particles pseudouridylate rRNA independently of their association with phosphorylated Nopp140.
Wang C, etal., Mol Cell Biol 2002 Dec;22(24):8457-66.
19.
The box C/D and H/ACA snoRNPs: key players in the modification, processing and the dynamic folding of ribosomal RNA.
Watkins NJ and Bohnsack MT, Wiley Interdiscip Rev RNA. 2012 May-Jun;3(3):397-414. doi: 10.1002/wrna.117. Epub 2011 Nov 7.
20.
Conserved composition of mammalian box H/ACA and box C/D small nucleolar ribonucleoprotein particles and their interaction with the common factor Nopp140.
Yang Y, etal., Mol Biol Cell 2000 Feb;11(2):567-77.
Dkc1 Rat Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCr8 X 157,751,651 - 157,757,796 (+) NCBI GRCr8 UTH_Rnor_SHR_Utx Y 2,037,843 - 2,053,706 (-) NCBI Rnor_SHR UTH_Rnor_SHR_Utx UTH_Rnor_SHRSP_BbbUtx_1.0 X 158,304,360 - 158,320,224 (+) NCBI Rnor_SHRSP UTH_Rnor_SHRSP_BbbUtx_1.0 UTH_Rnor_WKY_Bbb_1.0 X 155,976,554 - 155,992,422 (+) NCBI Rnor_WKY UTH_Rnor_WKY_Bbb_1.0 Rnor_6.0 X 155,844,914 - 155,862,363 (-) NCBI Rnor6.0 Rnor_6.0 rn6 Rnor6.0 Rnor_6.0 Ensembl X 155,844,857 - 155,862,475 (-) Ensembl Rnor6.0 rn6 Rnor6.0 Rnor_5.0 1 151,564,354 - 151,578,635 (-) NCBI Rnor5.0 Rnor_5.0 rn5 Rnor5.0 Celera 1 135,295,501 - 135,310,658 (-) ENTREZGENE Celera Cytogenetic Map X ;Y NCBI
DKC1 Human Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCh38 X 154,762,864 - 154,777,689 (+) NCBI GRCh38 GRCh38 hg38 GRCh38 GRCh38.p14 Ensembl X 154,762,742 - 154,777,689 (+) Ensembl GRCh38 hg38 GRCh38 GRCh37 X 153,991,139 - 154,005,964 (+) NCBI GRCh37 GRCh37 hg19 GRCh37 Build 36 X 153,644,344 - 153,659,154 (+) NCBI NCBI36 Build 36 hg18 NCBI36 Build 34 X 153,554,853 - 153,569,664 NCBI Celera X 154,149,596 - 154,164,527 (+) NCBI Celera Cytogenetic Map X q28 NCBI HuRef X 142,534,593 - 142,549,324 (+) NCBI HuRef CHM1_1 X 153,902,723 - 153,917,646 (+) NCBI CHM1_1 T2T-CHM13v2.0 X 152,999,274 - 153,014,101 (+) NCBI T2T-CHM13v2.0
Dkc1 Mouse Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl GRCm39 X 74,139,460 - 74,153,382 (+) NCBI GRCm39 GRCm39 mm39 GRCm39 Ensembl X 74,139,460 - 74,153,383 (+) Ensembl GRCm39 Ensembl GRCm38 X 75,095,854 - 75,109,776 (+) NCBI GRCm38 GRCm38 mm10 GRCm38 GRCm38.p6 Ensembl X 75,095,854 - 75,109,777 (+) Ensembl GRCm38 mm10 GRCm38 MGSCv37 X 72,341,193 - 72,355,115 (+) NCBI GRCm37 MGSCv37 mm9 NCBIm37 Celera X 66,500,704 - 66,514,600 (+) NCBI Celera Cytogenetic Map X A7.3 NCBI cM Map X 38.15 NCBI
Dkc1 Chinchilla Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChiLan1.0 Ensembl NW_004955594 847,815 - 856,510 (-) Ensembl ChiLan1.0 ChiLan1.0 NW_004955594 846,997 - 857,255 (-) NCBI ChiLan1.0 ChiLan1.0
DKC1 Bonobo Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl NHGRI_mPanPan1-v2 X 154,742,073 - 154,756,376 (+) NCBI NHGRI_mPanPan1-v2 NHGRI_mPanPan1 X 154,745,681 - 154,759,888 (+) NCBI NHGRI_mPanPan1 Mhudiblu_PPA_v0 X 144,243,493 - 144,257,419 (+) NCBI Mhudiblu_PPA_v0 Mhudiblu_PPA_v0 panPan3 PanPan1.1 X 154,084,412 - 154,098,475 (+) NCBI panpan1.1 PanPan1.1 panPan2 PanPan1.1 Ensembl X 154,084,412 - 154,098,475 (+) Ensembl panpan1.1 panPan2
DKC1 Dog Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl CanFam3.1 X 122,838,787 - 122,850,870 (+) NCBI CanFam3.1 CanFam3.1 canFam3 CanFam3.1 CanFam3.1 Ensembl X 122,838,645 - 122,850,884 (+) Ensembl CanFam3.1 canFam3 CanFam3.1 Dog10K_Boxer_Tasha X 107,832,003 - 107,844,116 (+) NCBI Dog10K_Boxer_Tasha ROS_Cfam_1.0 X 125,964,983 - 125,977,098 (+) NCBI ROS_Cfam_1.0 ROS_Cfam_1.0 Ensembl X 125,965,006 - 125,977,095 (+) Ensembl ROS_Cfam_1.0 Ensembl UMICH_Zoey_3.1 X 121,712,979 - 121,725,092 (+) NCBI UMICH_Zoey_3.1 UNSW_CanFamBas_1.0 X 124,236,220 - 124,248,333 (+) NCBI UNSW_CanFamBas_1.0 UU_Cfam_GSD_1.0 X 123,929,308 - 123,941,420 (+) NCBI UU_Cfam_GSD_1.0
Dkc1
DKC1 Pig Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl Sscrofa11.1 Ensembl X 125,218,923 - 125,229,525 (+) Ensembl Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa11.1 X 125,218,928 - 125,228,881 (+) NCBI Sscrofa11.1 Sscrofa11.1 susScr11 Sscrofa11.1 Sscrofa10.2 X 143,254,306 - 143,264,249 (-) NCBI Sscrofa10.2 Sscrofa10.2 susScr3
DKC1 Green Monkey Assembly Chr Position (strand) Source Genome Browsers JBrowse NCBI UCSC Ensembl ChlSab1.1 X 129,015,883 - 129,029,741 (+) NCBI ChlSab1.1 ChlSab1.1 chlSab2 ChlSab1.1 Ensembl X 129,016,046 - 129,030,001 (+) Ensembl ChlSab1.1 ChlSab1.1 Ensembl chlSab2 Vero_WHO_p1.0 NW_023666065 66,994,088 - 67,007,910 (+) NCBI Vero_WHO_p1.0 Vero_WHO_p1.0
Dkc1
.
Predicted Target Of
Count of predictions: 30 Count of miRNA genes: 29 Interacting mature miRNAs: 29 Transcripts: ENSRNOT00000074205 Prediction methods: Miranda, Rnahybrid Result types: miRGate_prediction
RH138539
Rat Assembly Chr Position (strand) Source JBrowse Rnor_6.0 X 155,845,378 - 155,845,963 NCBI Rnor6.0 Rnor_5.0 1 151,564,818 - 151,565,403 UniSTS Rnor5.0 Celera 1 135,295,965 - 135,296,550 UniSTS RH 3.4 Map 1 1621.02 UniSTS
Click on a value in the shaded box below the category label to view a detailed expression data table for that system.
alimentary part of gastrointestinal system
9
11
49
113
91
90
59
25
59
6
218
97
93
45
60
31
Too many to show, limit is 500. Download them if you would like to view them all.
Ensembl Acc Id:
ENSRNOT00000079862
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 155,844,857 - 155,862,475 (-) Ensembl
Ensembl Acc Id:
ENSRNOT00000089847 ⟹ ENSRNOP00000074005
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source Rnor_6.0 Ensembl X 155,844,914 - 155,862,363 (-) Ensembl
RefSeq Acc Id:
NM_133419 ⟹ NP_596910
RefSeq Status:
PROVISIONAL
Type:
CODING
Position:
Rat Assembly Chr Position (strand) Source GRCr8 X 157,751,651 - 157,757,796 (+) NCBI Rnor_6.0 X 155,844,914 - 155,862,363 (-) NCBI Rnor_5.0 1 151,564,354 - 151,578,635 (-) NCBI Celera 1 135,295,501 - 135,310,658 (-) ENTREZGENE
Sequence:
GTCCCGGCGGCGCGTGGTGACCGTTGGCGTGCGCGGTTCTCGGCTCGCGGCGGCGGTTAGCGGCGGTTGGCCGGGTTGTCTGCCTGCGACATGGCGGACGCGGAAGCCGCCATGACGTTCCCGAAGAA
hide sequence
RefSeq Acc Id:
NP_596910 ⟸ NM_133419
- UniProtKB:
Q499M9 (UniProtKB/Swiss-Prot), P40615 (UniProtKB/Swiss-Prot), A0A0G2K700 (UniProtKB/TrEMBL)
- Sequence:
MADAEAAMTFPKKHKKKKERKPLPEADVAEIQHAEDFLIKPESKAAQLDTSQWPLLLKNFDRLNVRTTHYTPIPCGSNPLKREIGEYVRTGFINLDKPSNPSSHEVVAWIRRILRVEKTGHSGTLDPK
hide sequence
Ensembl Acc Id:
ENSRNOP00000074005 ⟸ ENSRNOT00000089847
RGD ID: 13702036 Promoter ID: EPDNEW_R12560 Type: initiation region Name: Dkc1_1 Description: dyskerin pseudouridine synthase 1 SO ACC ID: SO:0000170 Source: EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/ ) Experiment Methods: Single-end sequencing. Position: Rat Assembly Chr Position (strand) Source Rnor_6.0 X 155,862,365 - 155,862,425 EPDNEW
Date
Current Symbol
Current Name
Previous Symbol
Previous Name
Description
Reference
Status
2016-02-24
Dkc1
dyskerin pseudouridine synthase 1
Dkc1
dyskeratosis congenita 1, dyskerin
Nomenclature updated to reflect human and mouse nomenclature
1299863 APPROVED
2005-01-20
Dkc1
dyskeratosis congenita 1, dyskerin
Symbol and Name status set to approved
1299863 APPROVED
2002-08-07
Dkc1
dyskeratosis congenita 1, dyskerin
Symbol and Name status set to provisional
70820 PROVISIONAL
Note Type
Note
Reference
gene_cellular_localization
protein localized to fibrillar component of the nucleolus, to coiled bodies, and to the nucleoplasm
728589
gene_expression
protein expressed in liver
728589
gene_homology
71% identical to putative yeast (S. cerevisiae) homolog, 50% identical to prokaryotic (E. coli) homolog
728589
gene_physical_interaction
protein colocalized with Nopp140 in nuclei of liver cells
728589
gene_protein
calculated mass of 52 kDa
728589
